Rhot1 Antibody - BSA Free | Novus Biologicals NBP1-59021 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Rhot1 Antibody - BSA Free

catalog :

NBP1-59021

quantity :

100 ul (also 20 ul)

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section, proximity ligation assay

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Lee I, Adhikari D, Carroll J. Miro1 depletion disrupts spatial distribution of mitochondria and leads to oocyte maturation defects. Front Cell Dev Biol. 2022;10:986454 pubmed publisher
Cangkrama M, Liu H, Whipman J, Zubair M, Matsushita M, Di Filippo M, et al. A Protumorigenic mDia2-MIRO1 Axis Controls Mitochondrial Positioning and Function in Cancer-Associated Fibroblasts. Cancer Res. 2022;82:3701-3717 pubmed publisher
Majstrowicz K, Honnert U, Nikolaus P, Schwarz V, Oeding S, Hemkemeyer S, et al. Coordination of mitochondrial and cellular dynamics by the actin-based motor Myo19. J Cell Sci. 2021;134: pubmed publisher
Kale A, Aldahish A, Shah G. Calcitonin receptor is required for T-antigen-induced prostate carcinogenesis. Oncotarget. 2020;11:858-874 pubmed publisher
Han H, Zhan Z, Xu J, Song Z. TMEFF2 inhibits pancreatic cancer cells proliferation, migration, and invasion by suppressing phosphorylation of the MAPK signaling pathway. Onco Targets Ther. 2019;12:11371-11382 pubmed publisher
Oeding S, Majstrowicz K, Hu X, Schwarz V, Freitag A, Honnert U, et al. Identification of Miro1 and Miro2 as mitochondrial receptors for myosin XIX. J Cell Sci. 2018;131: pubmed publisher
Jackson J, Robinson M. Reciprocal Regulation of Mitochondrial Dynamics and Calcium Signaling in Astrocyte Processes. J Neurosci. 2015;35:15199-213 pubmed publisher
Aguileta M, Korać J, Durcan T, Trempe J, Haber M, Gehring K, et al. The E3 ubiquitin ligase parkin is recruited to the 26 S proteasome via the proteasomal ubiquitin receptor Rpn13. J Biol Chem. 2015;290:7492-505 pubmed publisher

product information

master code :

NBP1-59021

SKU :

NBP1-59021

product name :

Rhot1 Antibody - BSA Free

unit size :

100 ul (also 20 ul)

description :

The Rhot1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Rhot1. This antibody reacts with human,mouse,rat. The Rhot1 Antibody - BSA Free has been validated for the following applications: Western Blot,Proximity Ligation Assay,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin.

target :

Rhot1

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEE
ITIPADVTPER.
Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse,Rat

theoretical molecular weight :

71 kDa

gene symbol :

RHOT1

accessionNumbers :

Q8IXI2

applications :

Western Blot,Proximity Ligation Assay,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin

USD :

459 USD

alt names :

ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage