beta-1 Adrenergic R/ADRB1 Antibody - BSA Free | Novus Biologicals NBP1-59007-100ul product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

catalog :

NBP1-59007-100ul

quantity :

100 ul

price :

409 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

more info or order :

Novus Biologicals product webpage

citations: 4

Reference
Alhamyani A, Napit P, Bheemanapally K, Sylvester P, Briski K. Singular versus combinatory glucose-sensitive signal control of metabolic sensor protein profiles in hypothalamic astrocyte cultures from each sex. Transl Neurosci. 2022;13:408-420 pubmed publisher
Alhamyani A, Napit P, Ali H, Ibrahim M, Briski K. Ventrolateral ventromedial hypothalamic nucleus GABA neuron adaptation to recurring Hypoglycemia correlates with up-regulated 5'-AMP-activated protein kinase activity. AIMS Neurosci. 2021;8:510-525 pubmed publisher
Alhamyani A, Mahmood A, Alshamrani A, Ibrahim M, Briski K. Central Type II Glucocorticoid Receptor Regulation of Ventromedial Hypothalamic Nucleus Glycogen Metabolic Enzyme and Glucoregulatory Neurotransmitter Marker Protein Expression in the Male Rat. J Endocrinol Diabetes. 2021;8: pubmed
Ibrahim M, Bheemanapally K, Sylvester P, Briski K. Norepinephrine Regulation of Adrenergic Receptor Expression, 5' AMP-Activated Protein Kinase Activity, and Glycogen Metabolism and Mass in Male Versus Female Hypothalamic Primary Astrocyte Cultures. ASN Neuro. 2020;12:1759091420974134 pubmed publisher

product information

master code :

NBP1-59007

SKU :

NBP1-59007-100ul

product name :

beta-1 Adrenergic R/ADRB1 Antibody - BSA Free

unit size :

100 ul

description :

The beta-1 Adrenergic R/ADRB1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to beta-1 Adrenergic R/ADRB1. This antibody reacts with human,mouse,rat. The beta-1 Adrenergic R/ADRB1 Antibody - BSA Free has been validated for the following applications: Western Blot.

target :

beta-1 Adrenergic R/ADRB1

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDF
VTNRAYAIASS.
Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse,Rat

theoretical molecular weight :

51 kDa

gene symbol :

ADRB1

accessionNumbers :

P08588

applications :

Western Blot

USD :

409 USD

alt names :

ADRB1RRHR, adrenergic, beta-1-, receptor, B1AR, beta-1 adrenergic receptor, Beta-1 adrenoceptor, Beta-1 adrenoreceptor, BETA1AR

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage