This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MASP2 Antibody
catalog :
NBP1-58986
quantity :
100 ul
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
| Reference |
|---|
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-58986
SKU :
NBP1-58986
product name :
MASP2 Antibody
description :
The MASP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MASP2. This antibody reacts with human. The MASP2 Antibody has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Western Blot.
target :
MASP2
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCE
YDFVKLSSGAK.
Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence
FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCE
YDFVKLSSGAK.
Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
27 kDa
gene symbol :
MASP2
accessionNumbers :
O00187
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Western Blot
USD :
399
USD 2025 :
409 USD
alt names :
EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
