This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ABP1/AOC1 Antibody
catalog :
NBP1-58006
quantity :
100 ul
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-58006
SKU :
NBP1-58006
product name :
ABP1/AOC1 Antibody
description :
The ABP1/AOC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABP1/AOC1. This antibody reacts with human. The ABP1/AOC1 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
ABP1/AOC1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGN
SVGFLLRPFNF.
Synthetic peptides corresponding to ABP1(amiloride binding protein 1 (amine oxidase (copper-containing))) The peptide sequence was selected from the C terminal of ABP1 (NP_001082). Peptide sequence
QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGN
SVGFLLRPFNF.
Synthetic peptides corresponding to ABP1(amiloride binding protein 1 (amine oxidase (copper-containing))) The peptide sequence was selected from the C terminal of ABP1 (NP_001082). Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
83 kDa
gene symbol :
AOC1
accessionNumbers :
P19801
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
409 USD
alt names :
ABP, amiloride binding protein 1 (amine oxidase (copper-containing)), Amiloride-binding protein, amiloride-sensitive amine oxidase, amiloride-sensitive amine oxidase [copper-containing], AOC1DAOamiloride-binding protein-1, DAO1, Diamine oxidase, EC 1.4.3, EC 1.4.3.22, Histaminase, KAO, Kidney amine oxidase
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
