This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
NSF Antibody
catalog :
NBP1-57536
quantity :
100 ul
price :
379 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus
master code :
NBP1-57536
SKU :
NBP1-57536
product name :
NSF Antibody
description :
The NSF Antibody from Novus is a rabbit polyclonal antibody to NSF. This antibody reacts with mouse. The NSF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
target :
NSF
category :
Primary Antibodies
sizes available :
100 ul
buffer :
PBS & 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG
KKVWIGIKKLL.
Synthetic peptides corresponding to NSF(N-ethylmaleimide-sensitive factor) The peptide sequence was selected from the C terminal of NSF. Peptide sequence
STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG
KKVWIGIKKLL.
Synthetic peptides corresponding to NSF(N-ethylmaleimide-sensitive factor) The peptide sequence was selected from the C terminal of NSF. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Mouse
gene symbol :
NSF
images :
https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Western-Blot-NBP1-57536-img0004.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Western-Blot-NBP1-57536-img0004.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57536-img0003.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57536-img0003.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Western-Blot-NBP1-57536-img0002.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/NSF-Antibody-Western-Blot-NBP1-57536-img0002.jpg
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
USD :
379 USD
alt names :
EC 3.6.4.6, NEM-sensitive fusion protein, N-ethylmaleimide-sensitive factor, N-ethylmaleimide-sensitive factor-like protein, N-ethylmaleimide-sensitive fusion protein, SKD2, vesicle-fusing ATPase, Vesicular-fusion protein NSF
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
