This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
RPLP0 Antibody
catalog :
NBP1-57528
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
citations: 1
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-57528
SKU :
NBP1-57528
product name :
RPLP0 Antibody
description :
The RPLP0 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPLP0. This antibody reacts with human. The RPLP0 Antibody has been validated for the following applications: Western Blot.
target :
RPLP0
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
1 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVR
NVASVCLQIGY.
Synthetic peptides corresponding to RPLP0(ribosomal protein, large, P0) The peptide sequence was selected from the middle region of RPLP0. Peptide sequence
PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVR
NVASVCLQIGY.
Synthetic peptides corresponding to RPLP0(ribosomal protein, large, P0) The peptide sequence was selected from the middle region of RPLP0. Peptide sequence
isotype :
IgG
purity :
Protein A purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
RPLP0
accessionNumbers :
P05388
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
60S acidic ribosomal protein P0, 60S ribosomal protein L10E, acidic ribosomal phosphoprotein P0, L10E, MGC111226, MGC88175, P0, PRLP0, ribosomal protein, large, P0, RPP0
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
