This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PUF60 Antibody
catalog :
NBP1-57501
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-57501
SKU :
NBP1-57501
product name :
PUF60 Antibody
description :
The PUF60 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PUF60. This antibody reacts with human. The PUF60 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
PUF60
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
1 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYD
QERFDNSDLSA.
Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence
EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYD
QERFDNSDLSA.
Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence
isotype :
IgG
purity :
Protein A purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
PUF60
accessionNumbers :
Q9UHX1-2
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
399 USD
alt names :
FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, siah-BP1, SIAHBP1pyrimidine tract binding splicing factor
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
