This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SNRPF Antibody
catalog :
NBP1-57463
quantity :
100 ul (also 20 ul)
price :
299 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
SKU :
NBP1-57463
product name :
SNRPF Antibody
unit size :
100 ul (also 20 ul)
Description :
The SNRPF Antibody from Novus is a rabbit polyclonal antibody to SNRPF. This antibody reacts with human, mouse, rat, bovine, canine, equine, guinea pig, goat, rabbit, yeast, zebrafish. The SNRPF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
target :
SNRPF
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGY
MNMQLANTEEY.
Synthetic peptides corresponding to SNRPF (small nuclear ribonucleoprotein polypeptide F) The peptide sequence was selected from the N terminal of SNRPF. Peptide sequence
MNMQLANTEEY.
Synthetic peptides corresponding to SNRPF (small nuclear ribonucleoprotein polypeptide F) The peptide sequence was selected from the N terminal of SNRPF. Peptide sequence
isotype :
IgG
purity :
Protein A purified
species :
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
gene symbol :
SNRPF
catalog number base :
NBP1-57463
accessionNumbers :
P62306
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
2020 Proposedprice USD :
299 USD
alt names :
PBSCF, Sm protein F, small nuclear ribonucleoprotein polypeptide F, SMF, Sm-Fsmall nuclear ribonucleoprotein F, snRNP-F
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
