This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Dnd1 Antibody
catalog :
NBP1-57258
quantity :
100 ul (also 20 ul)
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus
MasterCode :
NBP1-57258
SKU :
NBP1-57258
product name :
Dnd1 Antibody
unit sizes :
100 ul (also 20 ul)
description :
The Dnd1 Antibody from Novus is a rabbit polyclonal antibody to Dnd1. This antibody reacts with human. The Dnd1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
target :
Dnd1
category :
Primary Antibodies
buffer :
PBS & 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAV
SVRLLQALSES.
Synthetic peptides corresponding to DND1(dead end homolog 1 (zebrafish)) The peptide sequence was selected from the C terminal of DND1. Peptide sequence
HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAV
SVRLLQALSES.
Synthetic peptides corresponding to DND1(dead end homolog 1 (zebrafish)) The peptide sequence was selected from the C terminal of DND1. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
DND1
accessionNumbers :
Q8IYX4
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
USD :
329 USD
alt names :
dead end homolog 1 (zebrafish), dead end protein homolog 1, RBMS4MGC34750, RNA-binding motif, single-stranded-interacting protein 4
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
