product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
OMA1 Antibody - BSA Free
catalog :
NBP1-56970-100uL
quantity :
100 uL
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
more info or order :
citations: 1
product information
master code :
NBP1-56970
SKU :
NBP1-56970-100uL
product name :
OMA1 Antibody - BSA Free
unit size :
100 uL
description :
The OMA1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to OMA1. This antibody reacts with human. The OMA1 Antibody - BSA Free has been validated for the following applications: Western Blot.
target :
OMA1
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADK
IGLLLAAKACA.
Synthetic peptides corresponding to OMA1 (OMA1 homolog, zinc metallopeptidase (S. cerevisiae)) The peptide sequence was selected from the middle region of OMA1. Peptide sequence
WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADK
IGLLLAAKACA.
Synthetic peptides corresponding to OMA1 (OMA1 homolog, zinc metallopeptidase (S. cerevisiae)) The peptide sequence was selected from the middle region of OMA1. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
gene symbol :
OMA1
accessionNumbers :
Q96E52
applications :
Western Blot
USD :
409 USD
alt names :
2010001O09Rik, DAB1, EC 3.4.24.-, metalloprotease related protein 1, Metalloprotease-related protein 1, MPRP1, MPRP-1mitochondrial, OMA1 homolog, zinc metallopeptidase (S. cerevisiae), overlapping activity with M-AAA protease, YKR087C, ZMPOMA1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
