This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Matriptase / ST14 Antibody
catalog :
NBP1-56649
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
SKU :
NBP1-56649
product name :
Matriptase / ST14 Antibody
unit size :
100 ul
Description :
The Matriptase/ST14 Antibody from Novus is a rabbit polyclonal antibody to Matriptase/ST14. This antibody reacts with human, mouse, rat, porcine, bovine, canine, equine, guinea pig, rabbit. The Matriptase/ST14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
target :
Matriptase / ST14
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQT
TCENLLPQQIT.
Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence
TCENLLPQQIT.
Synthetic peptides corresponding to ST14(suppression of tumorigenicity 14 (colon carcinoma)) The peptide sequence was selected from the C terminal of ST14 (AAH18146). Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
theoretical molecular weight :
95 kDa
gene symbol :
ST14
catalog number base :
NBP1-56649
accessionNumbers :
Q8WVC1
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
2020 Proposedprice USD :
329 USD
alt names :
EC 3.4.21, HAI, Matriptase, Membrane-type serine protease 1, MT-SP1EC 3.4.21.109, prostamin, PRSS14, Serine protease 14, Serine protease TADG-15, SNC19MTSP1, suppression of tumorigenicity 14 (colon carcinoma), suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin), suppressor of tumorigenicity 14 protein, TADG15, TMPRSS14, tumor associated differentially expressed gene 15 protein, Tumor-associated differentially-expressed gene 15 protein
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
