This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
EPS8L1 Antibody
catalog :
NBP1-56615
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-56615
SKU :
NBP1-56615
product name :
EPS8L1 Antibody
description :
The EPS8L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPS8L1. This antibody reacts with human. The EPS8L1 Antibody has been validated for the following applications: Western Blot.
target :
EPS8L1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEA
VMEKQKKKVEG.
Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence
LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEA
VMEKQKKKVEG.
Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
EPS8L1
accessionNumbers :
Q8TE68
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
DRC3EPS8R1, epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1, EPS8-like 1, EPS8-like protein 1, EPS8-related protein 1, FLJ20258, MGC23164, MGC4642
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
