ACBD7 Antibody - BSA Free | Novus Biologicals NBP1-56527 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ACBD7 Antibody - BSA Free

catalog :

NBP1-56527

quantity :

100 ul

price :

399 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

OTI1C1

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 5

Reference
Kondo R, Akiba J, Ogasawara S, Nakashima O, Naito Y, Kusano H, et al. Programmed death-ligand 1 expression is an unfavorable prognostic factor of hepatocellular carcinoma after archiving sustained virologic response for hepatitis C virus infection. Oncol Lett. 2019;18:1458-1466 pubmed publisher
Li X, Guo W, Zha K, Jing X, Wang M, Zhang Y, et al. Enrichment of CD146+ Adipose-Derived Stem Cells in Combination with Articular Cartilage Extracellular Matrix Scaffold Promotes Cartilage Regeneration. Theranostics. 2019;9:5105-5121 pubmed publisher
Abe Y, Ogasawara S, Akiba J, Naito Y, Kondo R, Nakamura K, et al. Expression and role of regulator of G-protein signaling 5 in squamous cell carcinoma of the tongue. Clin Exp Dent Res. 2019;5:160-169 pubmed publisher
Umeno Y, Ogasawara S, Akiba J, Hattori S, Kusano H, Nakashima O, et al. Regulator of G-protein signaling 5 enhances portal vein invasion in hepatocellular carcinoma. Oncol Lett. 2018;15:1763-1770 pubmed publisher
Lanfray D, Caron A, Roy M, Laplante M, Morin F, Leprince J, et al. Involvement of the Acyl-CoA binding domain containing 7 in the control of food intake and energy expenditure in mice. elife. 2016;5: pubmed publisher

product information

master code :

NBP1-56527

SKU :

NBP1-56527

product name :

ACBD7 Antibody - BSA Free

unit size :

100 ul

description :

The ACBD7 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ACBD7. This antibody reacts with human,mouse. The ACBD7 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

ACBD7

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVG
DINIACPGMLD.
Synthetic peptides corresponding to ACBD7(acyl-Coenzyme A binding domain containing 7) The peptide sequence was selected from the N terminal of ACBD7 (NP_001034933). Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

10 kDa

gene symbol :

ACBD7

accessionNumbers :

Q8N6N7

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

399 USD

alt names :

acyl-CoA binding domain containing 7, acyl-CoA-binding domain-containing protein 7, acyl-Coenzyme A binding domain containing 7, bA455B2.2, FLJ38219, FLJ52263, MGC33893

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage