This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PARP7 Antibody
catalog :
NBP1-55363
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
SKU :
NBP1-55363
product name :
PARP7 Antibody
unit size :
100 ul
Description :
The PARP7 Antibody from Novus is a rabbit polyclonal antibody to PARP7. This antibody reacts with human, mouse, rat, porcine, bovine, canine, equine, rabbit. The PARP7 Antibody has been validated for the following applications: Western Blot.
target :
PARP7
category :
Primary Antibodies
buffer :
PBS 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFR
SRNQSTDENSL.
Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence
SRNQSTDENSL.
Synthetic peptides corresponding to TIPARP(TCDD-inducible poly(ADP-ribose) polymerase) The peptide sequence was selected from the N terminal of TIPARP. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit
theoretical molecular weight :
76 kDa
gene symbol :
TIPARP
catalog number base :
NBP1-55363
accessionNumbers :
Q7Z3E1
applications :
Western Blot
2020 Proposedprice USD :
329 USD
alt names :
DDF1, DKFZP434J214, DKFZp686N0351, DKFZp686P1838, EC 2.4.2.30, FLJ40466, PARP-1, PARP-7, PARP7DKFZp434J214, pART14, Poly [ADP-ribose] polymerase 7, RM1, TCDD-inducible poly [ADP-ribose] polymerase, TCDD-inducible poly(ADP-ribose) polymerase
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
