This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
RABGGTA Antibody
catalog :
NBP1-55183
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-55183
SKU :
NBP1-55183
product name :
RABGGTA Antibody
description :
The RABGGTA Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABGGTA. This antibody reacts with human. The RABGGTA Antibody has been validated for the following applications: Western Blot.
target :
RABGGTA
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQG
RLPEDVLLKEL.
Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence
ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQG
RLPEDVLLKEL.
Synthetic peptides corresponding to RABGGTA(Rab geranylgeranyltransferase, alpha subunit) The peptide sequence was selected from the N terminal of RABGGTA (NP_878256). Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
specificity :
This product is specific to Subunit or Isoform: alpha
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
65 kDa
gene symbol :
RABGGTA
accessionNumbers :
Q92696
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
EC 2.5.1.60, Geranylgeranyl transferase type II subunit alpha, geranylgeranyl transferase type-2 subunit alpha, protein prenyltransferase alpha subunit repeat containing 3, PTAR3, Rab geranylgeranyltransferase subunit alpha, Rab geranyl-geranyltransferase subunit alpha, Rab geranylgeranyltransferase, alpha subunit, Rab GG transferase alpha, Rab GGTase alpha
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
