This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CAR / NR1I3 Antibody
catalog :
NBP1-54935
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
SKU :
NBP1-54935
product name :
CAR / NR1I3 Antibody
unit size :
100 ul
Description :
The CAR/NR1I3 Antibody from Novus is a rabbit polyclonal antibody to CAR/NR1I3. This antibody reacts with human, mouse, rat, porcine, bovine, canine, equine, guinea pig, rabbit, zebrafish. The CAR/NR1I3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
target :
CAR / NR1I3
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFL
CGPLRYTIEDG.
Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1, group I, member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence
CGPLRYTIEDG.
Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1, group I, member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
theoretical molecular weight :
35 kDa
gene symbol :
NR1I3
catalog number base :
NBP1-54935
accessionNumbers :
Q14994
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
2020 Proposedprice USD :
329 USD
alt names :
CARCAR1, Constitutive activator of retinoid response, constitutive active receptor, Constitutive active response, Constitutive androstane receptor, MB67, MGC150433, MGC97144, MGC97209, nuclear receptor subfamily 1 group I member 3, nuclear receptor subfamily 1, group I, member 3, orphan nuclear hormone receptor, Orphan nuclear receptor MB67
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
