product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
NLRP1/NALP1 Antibody - BSA Free
catalog :
NBP1-54899
quantity :
100 ul
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - frozen section
more info or order :
citations: 22
Published Application/Species/Sample/DilutionReference
  • western blot; mouse; loading ...; fig 6a
Pérez Sisqués L, Sancho Balsells A, Solana Balaguer J, Campoy Campos G, Vives Isern M, Soler Palazón F, et al. RTP801/REDD1 contributes to neuroinflammation severity and memory impairments in Alzheimer's disease. Cell Death Dis. 2021;12:616 pubmed publisher
Muela Zarzuela I, Suárez Rivero J, Gallardo Orihuela A, Wang C, Izawa K, de Gregorio Procopio M, et al. NLRP1 inflammasome promotes senescence and senescence-associated secretory phenotype. Inflamm Res. 2024;73:1253-1266 pubmed publisher
Yu X, Benitez G, Wei P, Krylova S, Song Z, Liu L, et al. Involution of brown adipose tissue through a Syntaxin 4 dependent pyroptosis pathway. Nat Commun. 2024;15:2856 pubmed publisher
Muela Zarzuela I, Suárez Rivero J, Gallardo Orihuela A, Wang C, Izawa K, de Gregorio Procopio M, et al. NLRP1 inflammasome modulates senescence and senescence-associated secretory phenotype. bioRxiv. 2023;: pubmed publisher
Li Y, Li Z, He F, Qin C, Fan R, Zhang F, et al. Electroacupuncture alleviates cognitive dysfunction and neuronal pyroptosis in septic mice. Acupunct Med. 2022;:9645284221117847 pubmed publisher
P xe9 rez Sisqu xe9 s L, Solana Balaguer J, Campoy Campos G, Mart xed n Flores N, Sancho Balsells A, Vives Isern M, et al. RTP801/REDD1 Is Involved in Neuroinflammation and Modulates Cognitive Dysfunction in Huntington's Disease. Biomolecules. 2021;12: pubmed publisher
Chien C, Li J, Chien Y, Wang M, Yarmishyn A, Tsai P, et al. METTL3-dependent N6-methyladenosine RNA modification mediates the atherogenic inflammatory cascades in vascular endothelium. Proc Natl Acad Sci U S A. 2021;118: pubmed publisher
Chen S, Scott X, Ferrer Marcelo Y, Almeida V, Blackwelder P, Yavagal D, et al. Netosis and Inflammasomes in Large Vessel Occlusion Thrombi. Front Pharmacol. 2020;11:607287 pubmed publisher
Lyon H, Shome A, Rupenthal I, Green C, Mugisho O. Tonabersat Inhibits Connexin43 Hemichannel Opening and Inflammasome Activation in an In Vitro Retinal Epithelial Cell Model of Diabetic Retinopathy. Int J Mol Sci. 2020;22: pubmed publisher
Franke M, Bieber M, Kraft P, Weber A, Stoll G, Schuhmann M. The NLRP3 inflammasome drives inflammation in ischemia/reperfusion injury after transient middle cerebral artery occlusion in mice. Brain Behav Immun. 2021;92:223-233 pubmed publisher
Logan S, Storey K. Inflammasome signaling could be used to sense and respond to endogenous damage in brown but not white adipose tissue of a hibernating ground squirrel. Dev Comp Immunol. 2021;114:103819 pubmed publisher
Kim H, Seo J, Lee S, Ha K, Choi B, Shin Y, et al. AIM2 inflammasome contributes to brain injury and chronic post-stroke cognitive impairment in mice. Brain Behav Immun. 2020;87:765-776 pubmed publisher
Mousavi M, Hedayatpour A, Mortezaee K, Mohamadi Y, Abolhassani F, Hassanzadeh G. Schwann cell transplantation exerts neuroprotective roles in rat model of spinal cord injury by combating inflammasome activation and improving motor recovery and remyelination. Metab Brain Dis. 2019;: pubmed publisher
Chen S, Zuo Y, Huang L, Sherchan P, Zhang J, Yu Z, et al. The MC4 receptor agonist RO27-3225 inhibits NLRP1-dependent neuronal pyroptosis via the ASK1/JNK/p38 MAPK pathway in a mouse model of intracerebral haemorrhage. Br J Pharmacol. 2019;176:1341-1356 pubmed publisher
Chen K, Fan J, Luo Z, Yang Y, Xin W, Liu C. Reduction of SIRT1 epigenetically upregulates NALP1 expression and contributes to neuropathic pain induced by chemotherapeutic drug bortezomib. J Neuroinflammation. 2018;15:292 pubmed publisher
Park M, Iyer S, Xue X, Bragazzi Cunha J, Gu S, Moons D, et al. HIF1-alpha Regulates Acinar Cell Function and Response to Injury in Mouse Pancreas. Gastroenterology. 2018;154:1630-1634.e3 pubmed publisher
Lee H, Lee S, Kim N, Park K, Choi B, Shin Y, et al. Low-level light emitting diode (LED) therapy suppresses inflammasome-mediated brain damage in experimental ischemic stroke. J Biophotonics. 2017;10:1502-1513 pubmed publisher
Woehlbier U, Colombo A, Saaranen M, Pérez V, Ojeda J, Bustos F, et al. ALS-linked protein disulfide isomerase variants cause motor dysfunction. EMBO J. 2016;35:845-65 pubmed publisher
Gao X, Krokowski D, Guan B, Bederman I, Majumder M, Parisien M, et al. Quantitative H2S-mediated protein sulfhydration reveals metabolic reprogramming during the integrated stress response. elife. 2015;4:e10067 pubmed publisher
Kukita K, Tamura Y, Tanaka T, Kajiwara T, Kutomi G, Saito K, et al. Cancer-Associated Oxidase ERO1-α Regulates the Expression of MHC Class I Molecule via Oxidative Folding. J Immunol. 2015;194:4988-96 pubmed publisher
Fu Z, Lofqvist C, Shao Z, Sun Y, Joyal J, Hurst C, et al. Dietary ω-3 polyunsaturated fatty acids decrease retinal neovascularization by adipose-endoplasmic reticulum stress reduction to increase adiponectin. Am J Clin Nutr. 2015;101:879-88 pubmed publisher
Tan C, Zhang J, Tan M, Chen H, Meng D, Jiang T, et al. NLRP1 inflammasome is activated in patients with medial temporal lobe epilepsy and contributes to neuronal pyroptosis in amygdala kindling-induced rat model. J Neuroinflammation. 2015;12:18 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-54899
SKU :
NBP1-54899
product name :
NLRP1/NALP1 Antibody - BSA Free
units size :
100 ul
description :
The NLRP1/NALP1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to NLRP1/NALP1. This antibody reacts with human,mouse,rat. The NLRP1/NALP1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence.
target :
NLRP1/NALP1
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRF
QHVFYFSCREL.
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225).
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse,Rat
gene symbol :
NLRP1
top caption :
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899]
accessionNumbers :
Q9C000
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.