Aspartate Aminotransferase Antibody - BSA Free | Novus Biologicals NBP1-54778 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Aspartate Aminotransferase Antibody - BSA Free

catalog :

NBP1-54778

quantity :

100 ul

price :

409 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

DM1A

reactivity :

human, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Tsai P, Lee M, Jadhav U, Naqvi I, Madha S, Adler A, et al. Adaptation of pancreatic cancer cells to nutrient deprivation is reversible and requires glutamine synthetase stabilization by mTORC1. Proc Natl Acad Sci U S A. 2021;118: pubmed publisher
Hollinshead K, Parker S, Eapen V, Encarnación Rosado J, Sohn A, Oncu T, et al. Respiratory Supercomplexes Promote Mitochondrial Efficiency and Growth in Severely Hypoxic Pancreatic Cancer. Cell Rep. 2020;33:108231 pubmed publisher
Meléndez Rodríguez F, Urrutia A, Lorendeau D, Rinaldi G, Roche O, Böğürcü Seidel N, et al. HIF1α Suppresses Tumor Cell Proliferation through Inhibition of Aspartate Biosynthesis. Cell Rep. 2019;26:2257-2265.e4 pubmed publisher
Yang C, Stampouloglou E, Kingston N, Zhang L, Monti S, Varelas X. Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells. EMBO Rep. 2018;19: pubmed publisher
Mohammed R, Provitera L, Cavallaro G, Lattuada D, Ercoli G, Mosca F, et al. Vasomotor effects of hydrogen sulfide in human umbilical vessels. J Physiol Pharmacol. 2017;68:737-747 pubmed
Fujimura K, Wang H, Watson F, Klemke R. KRAS Oncoprotein Expression Is Regulated by a Self-Governing eIF5A-PEAK1 Feed-Forward Regulatory Loop. Cancer Res. 2018;78:1444-1456 pubmed publisher
Knudsen E, Balaji U, Freinkman E, McCue P, Witkiewicz A. Unique metabolic features of pancreatic cancer stroma: relevance to the tumor compartment, prognosis, and invasive potential. Oncotarget. 2016;7:78396-78411 pubmed publisher

product information

master code :

NBP1-54778

SKU :

NBP1-54778

product name :

Aspartate Aminotransferase Antibody - BSA Free

unit size :

100 ul

description :

The Aspartate Aminotransferase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Aspartate Aminotransferase. This antibody reacts with human,rat. The Aspartate Aminotransferase Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry.

target :

Aspartate Aminotransferase

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

1 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVG
AYRTDDCHPWV
Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence

isotype :

IgG

purity :

Protein A purified

species :

Human,Rat

theoretical molecular weight :

46 kDa

gene symbol :

GOT1

accessionNumbers :

P17174

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry

USD :

409 USD

alt names :

aspartate aminotransferase, cytoplasmic, ASTQTL1, CASPAT, CCAT, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, EC 2.6.1.1, EC 2.6.1.3, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), GOT1, growth-inhibiting protein 18, Transaminase A

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage