This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TST Antibody
catalog :
NBP1-54682
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-54682
SKU :
NBP1-54682
product name :
TST Antibody
description :
The TST Antibody from Novus Biologicals is a rabbit polyclonal antibody to TST. This antibody reacts with human. The TST Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
TST
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGH
PVTSEPSRPEP.
Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence
GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGH
PVTSEPSRPEP.
Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
33 kDa
gene symbol :
TST
accessionNumbers :
Q16762
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
399 USD
alt names :
EC 2.8.1, EC 2.8.1.1, MGC19578, RDSRhodanese, thiosulfate sulfurtransferase, thiosulfate sulfurtransferase (rhodanese)
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
