This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Myosin 1C Antibody
catalog :
NBP1-53071
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-53071
SKU :
NBP1-53071
product name :
Myosin 1C Antibody
description :
The Myosin 1C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin 1C. This antibody reacts with human. The Myosin 1C Antibody has been validated for the following applications: Western Blot.
target :
Myosin 1C
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGH
ILSYLLEKSRV.
Synthetic peptides corresponding to MYO1C(myosin IC) The peptide sequence was selected from the N terminal of MYO1C (NP_203693). Peptide sequence
NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGH
ILSYLLEKSRV.
Synthetic peptides corresponding to MYO1C(myosin IC) The peptide sequence was selected from the N terminal of MYO1C (NP_203693). Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
specificity :
MYO1C isoforms 1, 2 and 3
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
118 kDa
gene symbol :
MYO1C
accessionNumbers :
O00159-2
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
FLJ23903, MMIb, MMI-beta, Myosin I beta, myosin IC, myosin-I beta, myosin-Ic, myr2, NMI, nuclear myosin I
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
