This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CDYL Antibody
catalog :
NBP1-52986
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-52986
SKU :
NBP1-52986
product name :
CDYL Antibody
description :
The CDYL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDYL. This antibody reacts with human. The CDYL Antibody has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence.
target :
CDYL
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNS
NFSKTSPKALV.
Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence
YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNS
NFSKTSPKALV.
Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
CDYL
accessionNumbers :
Q9Y232
applications :
Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
399
USD 2025 :
399 USD
alt names :
CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like), CDY-like, CDY-like, autosomal, chromodomain protein, Y chromosome-like, chromodomain protein, Y-like, chromodomain Y-like protein, DKFZP586C1622, EC 2.3.1.48, MGC131936, testis-specific chromodomain Y-like protein
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
