Cystathionase Antibody - BSA Free | Novus Biologicals NBP1-52849 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Cystathionase Antibody - BSA Free

catalog :

NBP1-52849

quantity :

100 ul

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Angulo J, Fern xe1 ndez A, Sevilleja Ortiz A, S xe1 nchez Ferrer A, Rodr xed guez Ma xf1 as L, El Assar M. Upregulation of Orai Channels Contributes to Aging-Related Vascular Alterations in Rat Coronary Arteries. Int J Mol Sci. 2023;24: pubmed publisher
Browe B, Peng Y, Nanduri J, Prabhakar N, Garcia A. Gasotransmitter modulation of hypoglossal motoneuron activity. elife. 2023;12: pubmed publisher
El Assar M, Garc xed a Rojo E, Sevilleja Ortiz A, S xe1 nchez Ferrer A, Fern xe1 ndez A, Garc xed a G xf3 mez B, et al. Functional Role of STIM-1 and Orai1 in Human Microvascular Aging. Cells. 2022;11: pubmed publisher
Sevilleja Ortiz A, El Assar M, García Rojo E, García Gómez B, Fernández A, Sánchez Ferrer A, et al. Ageing-induced hypercontractility is related to functional enhancement of STIM/Orai and upregulation of Orai 3 in rat and human penile tissue. Mech Ageing Dev. 2021;200:111590 pubmed publisher
La Fuente J, Sevilleja Ortiz A, García Rojo E, El Assar M, Fernández A, Pepe Cardoso A, et al. Erectile dysfunction is associated with defective L-cysteine/hydrogen sulfide pathway in human corpus cavernosum and penile arteries. Eur J Pharmacol. 2020;884:173370 pubmed publisher
Yuan G, Peng Y, Khan S, Nanduri J, Singh A, Vasavda C, et al. H2S production by reactive oxygen species in the carotid body triggers hypertension in a rodent model of sleep apnea. Sci Signal. 2016;9:ra80 pubmed publisher

product information

master code :

NBP1-52849

SKU :

NBP1-52849

product name :

Cystathionase Antibody - BSA Free

unit size :

100 ul

description :

The Cystathionase Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Cystathionase. This antibody reacts with human,mouse,rat. The Cystathionase Antibody - BSA Free has been validated for the following applications: Western Blot,IF/IHC,Immunoprecipitation.

target :

Cystathionase

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVA
ALDGAKYCLAF.
Synthetic peptides corresponding to CTH(cystathionase (cystathionine gamma-lyase)) The peptide sequence was selected from the N terminal of human CTH. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse,Rat

theoretical molecular weight :

44 kDa

gene symbol :

CTH

accessionNumbers :

P32929

applications :

Western Blot,IF/IHC,Immunoprecipitation

USD :

459 USD

alt names :

cystathionase (cystathionine gamma-lyase), cystathionine gamma-lyase, cysteine desulfhydrase, EC 4.4.1, EC 4.4.1.1, gamma-cystathionase, homoserine deaminase, homoserine dehydratase, MGC9471

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage