SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free | Novus Biologicals NBP1-52823 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free

catalog :

NBP1-52823

quantity :

100 ul

price :

399 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

962610

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 4

Reference
Rore H, Owen N, Piña Aguilar R, Docherty K, Sekido R. Testicular somatic cell-like cells derived from embryonic stem cells induce differentiation of epiblasts into germ cells. Commun Biol. 2021;4:802 pubmed publisher
Pan S, Guo S, Liu L, Yang X, Liang H. Functional study of a novel c.630delG (p.Y211Tfs*85) mutation in NR5A1 gene in a Chinese boy with 46,XY disorders of sex development. J Assist Reprod Genet. 2020;37:477-486 pubmed publisher
Savchuk I, Morvan M, Antignac J, Kurek M, le Bizec B, Soder O, et al. Ontogenesis of human fetal testicular steroidogenesis at early gestational age. Steroids. 2019;141:96-103 pubmed publisher
Savchuk I, Morvan M, Antignac J, Gemzell Danielsson K, le Bizec B, Soder O, et al. Androgenic potential of human fetal adrenals at the end of the first trimester. Endocr Connect. 2017;6:348-359 pubmed publisher

product information

master code :

NBP1-52823

SKU :

NBP1-52823

product name :

SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free

unit size :

100 ul

description :

The SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SF-1/NR5A1/Steroidogenic Factor 1. This antibody reacts with human,mouse. The SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free has been validated for the following applications: Simple Western,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

SF-1/NR5A1/Steroidogenic Factor 1

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLA
GYLYPAFPGRA.
Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

52 kDa

gene symbol :

NR5A1

accessionNumbers :

Q13285

applications :

Simple Western,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

399 USD

alt names :

AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage