product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MRP1 Antibody (IU5C1) - BSA Free
catalog :
NB110-57131
quantity :
0.1 ml (also 0.025 ml)
price :
409 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
IU5C1
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| Chen Q, Yang Y, Li L, Zhang J. The amino terminus of the human multidrug resistance transporter ABCC1 has a U-shaped folding with a gating function. J Biol Chem. 2006;281:31152-63 pubmed
|
product information
master code :
NB110-57131
SKU :
NB110-57131
product name :
MRP1 Antibody (IU5C1) - BSA Free
unit size :
0.1 ml (also 0.025 ml)
description :
The MRP1 Antibody (IU5C1) - BSA Free from Novus is a mouse monoclonal antibody to MRP1. This antibody reacts with human,mouse. The MRP1 Antibody (IU5C1) - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
MRP1
category :
Primary Antibodies
buffer :
PBS
clonality :
Monoclonal
clone :
IU5C1
concentration :
1.0 mg/ml
conjugate :
Unconjugated
host :
Mouse
immunogen :
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
isotype :
IgG1
purity :
Protein G purified
species :
Human,Mouse
theoretical molecular weight :
172 kDa
gene symbol :
ABCC1
accessionNumbers :
P33527
applications :
Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
409 USD
alt names :
ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein
storage :
Store at -20C. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
