LASS6 Antibody (5H7) | Novus Biologicals H00253782-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

LASS6 Antibody (5H7)

catalog :

H00253782-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5H7

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Lee W, Maa xdf M, Quach A, Pošćić N, Prangley H, Pallott E, et al. Dependence of ABCB1 transporter expression and function on distinct sphingolipids generated by ceramide synthases-2 and -6 in chemoresistant renal cancer. J Biol Chem. 2022;298:101492 pubmed publisher
Pani T, Rajput K, Kar A, Sharma H, Basak R, Medatwal N, et al. Alternative splicing of ceramide synthase 2 alters levels of specific ceramides and modulates cancer cell proliferation and migration in Luminal B breast cancer subtype. Cell Death Dis. 2021;12:171 pubmed publisher
Suzuki M, Cao K, Kato S, Mizutani N, Tanaka K, Arima C, et al. CERS6 required for cell migration and metastasis in lung cancer. J Cell Mol Med. 2020;24:11949-11959 pubmed publisher
Uen Y, Fang C, Lin C, Hseu Y, Hung S, Sun D, et al. Ceramide synthase 6 predicts the prognosis of human gastric cancer: It functions as an oncoprotein by dysregulating the SOCS2/JAK2/STAT3 pathway. Mol Carcinog. 2018;57:1675-1689 pubmed publisher
Li S, Wu Y, Ding Y, Yu M, Ai Z. CerS6 regulates cisplatin resistance in oral squamous cell carcinoma by altering mitochondrial fission and autophagy. J Cell Physiol. 2018;233:9416-9425 pubmed publisher
Gerl M, Bittl V, Kirchner S, Sachsenheimer T, Brunner H, Lüchtenborg C, et al. Sphingosine-1-Phosphate Lyase Deficient Cells as a Tool to Study Protein Lipid Interactions. PLoS ONE. 2016;11:e0153009 pubmed publisher
Suzuki M, Cao K, Kato S, Komizu Y, Mizutani N, Tanaka K, et al. Targeting ceramide synthase 6-dependent metastasis-prone phenotype in lung cancer cells. J Clin Invest. 2016;126:254-65 pubmed publisher
Novgorodov S, Riley C, Keffler J, Yu J, Kindy M, Macklin W, et al. SIRT3 Deacetylates Ceramide Synthases: IMPLICATIONS FOR MITOCHONDRIAL DYSFUNCTION AND BRAIN INJURY. J Biol Chem. 2016;291:1957-73 pubmed publisher
Jensen S, Calvert A, Volpert G, Kouri F, Hurley L, Luciano J, et al. Bcl2L13 is a ceramide synthase inhibitor in glioblastoma. Proc Natl Acad Sci U S A. 2014;111:5682-7 pubmed publisher
Laviad E, Kelly S, Merrill A, Futerman A. Modulation of ceramide synthase activity via dimerization. J Biol Chem. 2012;287:21025-33 pubmed publisher
Yamane M, Miyazawa K, Moriya S, Abe A, Yamane S. D,L-Threo-1-phenyl-2-decanoylamino-3-morpholino-1-propanol (DL-PDMP) increases endoplasmic reticulum stress, autophagy and apoptosis accompanying ceramide accumulation via ceramide synthase 5 protein expression in A549 cells. Biochimie. 2011;93:1446-59 pubmed publisher
Mullen T, Spassieva S, Jenkins R, Kitatani K, Bielawski J, Hannun Y, et al. Selective knockdown of ceramide synthases reveals complex interregulation of sphingolipid metabolism. J Lipid Res. 2011;52:68-77 pubmed publisher
Maruyama H, Morino H, Ito H, Izumi Y, Kato H, Watanabe Y, et al. Mutations of optineurin in amyotrophic lateral sclerosis. Nature. 2010;465:223-6 pubmed publisher
Mesicek J, Lee H, Feldman T, Jiang X, Skobeleva A, Berdyshev E, et al. Ceramide synthases 2, 5, and 6 confer distinct roles in radiation-induced apoptosis in HeLa cells. Cell Signal. 2010;22:1300-7 pubmed publisher

product information

brand :

Novus

master code :

H00253782-M01

SKU :

H00253782-M01

product name :

LASS6 Antibody (5H7)

unit size :

0.1 mg

seo description :

The LASS6 Antibody (5H7) - Azide and BSA Free from Novus is a mouse monoclonal antibody to LASS6. This antibody reacts with human,mouse. The LASS6 Antibody (5H7) - Azide and BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

LASS6

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5H7

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500

host :

Mouse

immunogen :

PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLE
GLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR
LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

LASS6 - LAG1 longevity assurance homolog 6 (S

gene symbol :

CERS6

accessionNumbers :

NP_982288

applications :

ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunoprecipitation,Western Blot

USD :

529 USD

alt names :

CerS6, LAG1 homolog, ceramide synthase 6, LAG1 longevity assurance homolog 6, LAG1 longevity assurance homolog 6 (S. cerevisiae), longevity assurance homolog 6, MGC129949, MGC129950

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage