product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Shugoshin Antibody (3C11)
catalog :
H00151648-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C11
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 18
Reference
Chen Q, Zhang M, Pan X, Yuan X, Zhou L, Yan L, et al. Bub1 and CENP-U redundantly recruit Plk1 to stabilize kinetochore-microtubule attachments and ensure accurate chromosome segregation. Cell Rep. 2021;36:109740 pubmed publisher
Zhang M, Liang C, Chen Q, Yan H, Xu J, Zhao H, et al. Histone H2A phosphorylation recruits topoisomerase IIα to centromeres to safeguard genomic stability. EMBO J. 2020;39:e101863 pubmed publisher
Vallardi G, Allan L, Crozier L, Saurin A. Division of labour between PP2A-B56 isoforms at the centromere and kinetochore. elife. 2019;8: pubmed publisher
Liang C, Zhang Z, Chen Q, Yan H, Zhang M, Xiang X, et al. A positive feedback mechanism ensures proper assembly of the functional inner centromere during mitosis in human cells. J Biol Chem. 2019;294:1437-1450 pubmed publisher
Song A, Galli A, Leclerc S, Nattel S, Mandato C, Andelfinger G. Dataset of Sgo1 expression in cardiac, gastrointestinal, hepatic and neuronal tissue in mouse. Data Brief. 2017;13:731-737 pubmed publisher
Zielinska A, Holubcová Z, Blayney M, Elder K, Schuh M. Sister kinetochore splitting and precocious disintegration of bivalents could explain the maternal age effect. elife. 2015;4:e11389 pubmed publisher
Asghar A, Lajeunesse A, Dulla K, Combes G, Thebault P, Nigg E, et al. Bub1 autophosphorylation feeds back to regulate kinetochore docking and promote localized substrate phosphorylation. Nat Commun. 2015;6:8364 pubmed publisher
van de Werken C, Avo Santos M, Laven J, Eleveld C, Fauser B, Lens S, et al. Chromosome segregation regulation in human zygotes: altered mitotic histone phosphorylation dynamics underlying centromeric targeting of the chromosomal passenger complex. Hum Reprod. 2015;30:2275-91 pubmed publisher
Nijenhuis W, Vallardi G, Teixeira A, Kops G, Saurin A. Negative feedback at kinetochores underlies a responsive spindle checkpoint signal. Nat Cell Biol. 2014;16:1257-64 pubmed publisher
Garcia Cruz R, Brieño M, Roig I, Grossmann M, Velilla E, Pujol A, et al. Dynamics of cohesin proteins REC8, STAG3, SMC1 beta and SMC3 are consistent with a role in sister chromatid cohesion during meiosis in human oocytes. Hum Reprod. 2010;25:2316-27 pubmed publisher
Nozawa R, Nagao K, Masuda H, Iwasaki O, Hirota T, Nozaki N, et al. Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation. Nat Cell Biol. 2010;12:719-27 pubmed publisher
Shouse G, Nobumori Y, Liu X. A B56gamma mutation in lung cancer disrupts the p53-dependent tumor-suppressor function of protein phosphatase 2A. Oncogene. 2010;29:3933-41 pubmed publisher
Wang L, Mayer B, Stemmann O, Nigg E. Centromere DNA decatenation depends on cohesin removal and is required for mammalian cell division. J Cell Sci. 2010;123:806-13 pubmed publisher
Hayashi Takanaka Y, Yamagata K, Nozaki N, Kimura H. Visualizing histone modifications in living cells: spatiotemporal dynamics of H3 phosphorylation during interphase. J Cell Biol. 2009;187:781-90 pubmed publisher
Thein K, Kleylein Sohn J, Nigg E, Gruneberg U. Astrin is required for the maintenance of sister chromatid cohesion and centrosome integrity. J Cell Biol. 2007;178:345-54 pubmed
Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, et al. Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis. Cell Res. 2007;17:608-18 pubmed
Lock P, I S, Straffon A, Schieb H, Hovens C, Stylli S. Spred-2 steady-state levels are regulated by phosphorylation and Cbl-mediated ubiquitination. Biochem Biophys Res Commun. 2006;351:1018-23 pubmed
Dai J, Sullivan B, Higgins J. Regulation of mitotic chromosome cohesion by Haspin and Aurora B. Dev Cell. 2006;11:741-50 pubmed
product information
brand :
Novus
master code :
H00151648-M01
SKU :
H00151648-M01
product name :
Shugoshin Antibody (3C11)
unit size :
0.1 mg
seo description :
The Shugoshin Antibody (3C11) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Shugoshin. This antibody reacts with human,mouse,rat. The Shugoshin Antibody (3C11) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Functional.
target :
Shugoshin
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3C11
conjugate :
Unconjugated
dilution :
Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin, Functional
host :
Mouse
immunogen :
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSF
IAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEA
QDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEI
CSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQ
IEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKK
NKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLC
FLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREF
VSRFPDCRKCKLETHICLR
SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human,Mouse,Rat
specificity :
SGOL1 - shugoshin-like 1 (S
gene symbol :
SGO1
accessionNumbers :
AAH17867
applications :
ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Functional,Western Blot,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe)
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.