COMMD1 Antibody (2A12) | Novus Biologicals H00150684-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

COMMD1 Antibody (2A12)

catalog :

H00150684-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2A12

reactivity :

human

application :

western blot, ELISA, immunoprecipitation

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Daghero H, Fern xe1 ndez Mass xf3 J, Astrada S, Guerra Vallesp xed M, Bollati Fogol xed n M. The Anticancer Peptide CIGB-552 Exerts Anti-Inflammatory and Anti-Angiogenic Effects through COMMD1. Molecules. 2020;26: pubmed publisher
O Hara A, Simpson J, Morin P, Loveridge C, Williams A, Novo S, et al. p300-mediated acetylation of COMMD1 regulates its stability, and the ubiquitylation and nucleolar translocation of the RelA NF-ÎºB subunit. J Cell Sci. 2014;127:3659-65 pubmed publisher
Schilling D, Bayer C, Li W, Molls M, Vaupel P, Multhoff G. Radiosensitization of normoxic and hypoxic h1339 lung tumor cells by heat shock protein 90 inhibition is independent of hypoxia inducible factor-1?. PLoS ONE. 2012;7:e31110 pubmed publisher
Drévillon L, Tanguy G, Hinzpeter A, Arous N, de Becdelievre A, Aissat A, et al. COMMD1-mediated ubiquitination regulates CFTR trafficking. PLoS ONE. 2011;6:e18334 pubmed publisher
Vonk W, Wijmenga C, Berger R, van De Sluis B, Klomp L. Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1. J Biol Chem. 2010;285:28991-9000 pubmed publisher
Weiss K, Lozoya J, Tuma S, Gotthardt D, Reichert J, Ehehalt R, et al. Copper-induced translocation of the Wilson disease protein ATP7B independent of Murr1/COMMD1 and Rab7. Am J Pathol. 2008;173:1783-94 pubmed publisher
Burkhead J, Morgan C, Shinde U, Haddock G, Lutsenko S. COMMD1 forms oligomeric complexes targeted to the endocytic membranes via specific interactions with phosphatidylinositol 4,5-bisphosphate. J Biol Chem. 2009;284:696-707 pubmed publisher
Maine G, Mao X, Muller P, Komarck C, Klomp L, Burstein E. COMMD1 expression is controlled by critical residues that determine XIAP binding. Biochem J. 2009;417:601-9 pubmed publisher
Huang Y, Wu M, Li H. Tumor suppressor ARF promotes non-classic proteasome-independent polyubiquitination of COMMD1. J Biol Chem. 2008;283:11453-60 pubmed publisher
de Bie P, van De Sluis B, Burstein E, van de Berghe P, Muller P, Berger R, et al. Distinct Wilson's disease mutations in ATP7B are associated with enhanced binding to COMMD1 and reduced stability of ATP7B. Gastroenterology. 2007;133:1316-26 pubmed
Maine G, Mao X, Komarck C, Burstein E. COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase. EMBO J. 2007;26:436-47 pubmed

product information

brand :

Novus

master code :

H00150684-M01

SKU :

H00150684-M01

product name :

COMMD1 Antibody (2A12)

unit size :

0.1 mg

seo description :

The COMMD1 Antibody (2A12) - Azide and BSA Free from Novus is a mouse monoclonal antibody to COMMD1. This antibody reacts with human. The COMMD1 Antibody (2A12) - Azide and BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,ELISA.

target :

COMMD1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2A12

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunoprecipitation

host :

Mouse

immunogen :

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQL
YPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTA
QTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNS
GLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQES
EFLCLEFDEVKVNQILKTLSEVEESISTLISQPN
COMMD1 (AAH22046.1, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human

specificity :

COMMD1 - copper metabolism (Murr1) domain containing 1

gene symbol :

COMMD1

accessionNumbers :

AAH22046

applications :

ELISA,Immunoprecipitation,Western Blot

USD :

499 USD

alt names :

C2orf5, COMM domain-containing protein 1, copper metabolism (Murr1) domain containing 1, copper metabolism gene MURR1, MGC27155, MURR1chromosome 2 open reading frame 5 (MURR1), Protein Murr1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage