NEDD1 Antibody (7D10) | Novus Biologicals H00121441-M05 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

NEDD1 Antibody (7D10)

catalog :

H00121441-M05

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

7D10

reactivity :

human, mouse, rat, bovine

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Tim xf3 n P xe9 rez K, Scrofani J, Vernos I. NEDD1-S411 phosphorylation plays a critical function in the coordination of microtubule nucleation during mitosis. Biol Open. 2022;11: pubmed publisher
Schneider I, de Ruijter Villani M, Hossain M, Stout T, Ellenberg J. Dual spindles assemble in bovine zygotes despite the presence of paternal centrosomes. J Cell Biol. 2021;220: pubmed publisher
Baumann C, Wang X, Yang L, Viveiros M. Error-prone meiotic division and subfertility in mice with oocyte-conditional knockdown of pericentrin. J Cell Sci. 2017;130:1251-1262 pubmed publisher
Uehara R, Kamasaki T, Hiruma S, Poser I, Yoda K, Yajima J, et al. Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission. Mol Biol Cell. 2016;27:812-27 pubmed publisher
Lecland N, Lüders J. The dynamics of microtubule minus ends in the human mitotic spindle. Nat Cell Biol. 2014;16:770-8 pubmed publisher
Tamura A, Huang T, Marikawa Y. Impact of vitrification on the meiotic spindle and components of the microtubule-organizing center in mouse mature oocytes. Biol Reprod. 2013;89:112 pubmed publisher
Uehara R, Goshima G. Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase. J Cell Biol. 2010;191:259-67 pubmed publisher
Teixido Travesa N, Villen J, Lacasa C, Bertran M, Archinti M, Gygi S, et al. The gammaTuRC revisited: a comparative analysis of interphase and mitotic human gammaTuRC redefines the set of core components and identifies the novel subunit GCP8. Mol Biol Cell. 2010;21:3963-72 pubmed publisher
Archinti M, Lacasa C, Teixido Travesa N, Lüders J. SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression. J Cell Sci. 2010;123:3039-46 pubmed publisher
Stiess M, Maghelli N, Kapitein L, Gomis Rüth S, Wilsch Bräuninger M, Hoogenraad C, et al. Axon extension occurs independently of centrosomal microtubule nucleation. Science. 2010;327:704-7 pubmed publisher
Zhu H, Fang K, Fang G. FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle and the centrosomes. J Cell Sci. 2009;122:2750-9 pubmed publisher
Haren L, Stearns T, Lüders J. Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components. PLoS ONE. 2009;4:e5976 pubmed publisher
Zhu H, Coppinger J, Jang C, Yates J, Fang G. FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle. J Cell Biol. 2008;183:835-48 pubmed publisher

product information

brand :

Novus

master code :

H00121441-M05

SKU :

H00121441-M05

product name :

NEDD1 Antibody (7D10)

unit size :

0.1 mg

seo description :

The NEDD1 Antibody (7D10) - Azide and BSA Free from Novus is a mouse monoclonal antibody to NEDD1. This antibody reacts with bovine,human,mouse,porcine,rat,sheep. The NEDD1 Antibody (7D10) - Azide and BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunoblotting.

target :

NEDD1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

7D10

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting

host :

Mouse

immunogen :

AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQET
LDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSV
NEGLVAEIERLREENKRLRAHF
NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Bovine,Human,Mouse,Porcine,Rat,Sheep

specificity :

NEDD1 - neural precursor cell expressed, developmentally down-regulated 1

gene symbol :

NEDD1

accessionNumbers :

NP_690869

applications :

ELISA,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunoblotting,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

FLJ35902, GCP-WD, NEDD-1, Neural precursor cell expressed developmentally down-regulated protein 1, neural precursor cell expressed, developmentally down-regulated 1, protein NEDD1, TUBGCP7

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage