Twist-2 Antibody (3C8) | Novus Biologicals H00117581-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Twist-2 Antibody (3C8)

catalog :

H00117581-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C8

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Radnaa E, RICHARDSON L, Goldman B, Burks J, Baljinnyam T, Vora N, et al. Stress signaler p38 mitogen-activated kinase activation: a cause for concern?. Clin Sci (Lond). 2022;136:1591-1614 pubmed publisher
Kim J, Park M, Ohn J, Seong R, Chung J, Kim K, et al. Twist2-driven chromatin remodeling governs the postnatal maturation of dermal fibroblasts. Cell Rep. 2022;39:110821 pubmed publisher
Hwang S, Lee C, Park K, Oh S, Jeon S, Kang B, et al. Twist2 promotes CD8+ T-cell differentiation by repressing ThPOK expression. Cell Death Differ. 2020;27:3053-3064 pubmed publisher
Zhang J, Lin X, Wu L, Huang J, Jiang W, Kipps T, et al. Aurora B induces epithelial-mesenchymal transition by stabilizing Snail1 to promote basal-like breast cancer metastasis. Oncogene. 2020;39:2550-2567 pubmed publisher
Singh M, Venugopal C, Tokar T, Brown K, McFarlane N, Bakhshinyan D, et al. RNAi screen identifies essential regulators of human brain metastasis-initiating cells. Acta Neuropathol. 2017;134:923-940 pubmed publisher
Oh J, Lee C, Oh S, Jeon S, Choi J, Hwang S, et al. Expression of Twist2 is controlled by T-cell receptor signaling and determines the survival and death of thymocytes. Cell Death Differ. 2016;23:1804-1814 pubmed publisher
Rodrigues I, Lavorato Rocha A, de M Maia B, Stiepcich M, de Carvalho F, Baiocchi G, et al. Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV. Br J Cancer. 2013;109:184-94 pubmed publisher
Yu H, Jin G, Liu K, Dong H, Yu H, Duan J, et al. Twist2 is a valuable prognostic biomarker for colorectal cancer. World J Gastroenterol. 2013;19:2404-11 pubmed publisher
Mao Y, Zhang N, Xu J, Ding Z, Zong R, Liu Z. Significance of heterogeneous Twist2 expression in human breast cancers. PLoS ONE. 2012;7:e48178 pubmed publisher
Plasilova M, Chattopadhyay C, Ghosh A, Wenzel F, Demougin P, Noppen C, et al. Discordant gene expression signatures and related phenotypic differences in lamin A- and A/C-related Hutchinson-Gilford progeria syndrome (HGPS). PLoS ONE. 2011;6:e21433 pubmed publisher
Carvalho S, Stiepcich M, Fregnani J, Nonogaki S, Rocha R, Soares F. Evaluation of prognostic factors in stage IIA breast tumors and their correlation with mortality risk. Clinics (Sao Paulo). 2011;66:607-12 pubmed
Fang X, Cai Y, Liu J, Wang Z, Wu Q, Zhang Z, et al. Twist2 contributes to breast cancer progression by promoting an epithelial-mesenchymal transition and cancer stem-like cell self-renewal. Oncogene. 2011;30:4707-20 pubmed publisher
Murakami M, Ohkuma M, Nakamura M. Molecular mechanism of transforming growth factor-beta-mediated inhibition of growth arrest and differentiation in a myoblast cell line. Dev Growth Differ. 2008;50:121-30 pubmed publisher

product information

brand :

Novus

master code :

H00117581-M01

SKU :

H00117581-M01

product name :

Twist-2 Antibody (3C8)

unit size :

0.1 mg

seo description :

The Twist-2 Antibody (3C8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Twist-2. This antibody reacts with human,mouse. The Twist-2 Antibody (3C8) - Azide and BSA Free has been validated for the following applications: IF/IHC,CyTOF-ready,ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence.

target :

Twist-2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3C8

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Chromatin Immunoprecipitation (ChIP)

host :

Mouse

immunogen :

MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKS
SEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFL
YQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSM
SASH
TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse

specificity :

TWIST2 - twist homolog 2 (Drosophila)

gene symbol :

TWIST2

accessionNumbers :

AAH33168

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence,IF/IHC,CyTOF-ready

USD :

529 USD

alt names :

BHLHA39, bHLHa39twist-related bHLH protein Dermo1, Class A basic helix-loop-helix protein 39, Dermis-expressed protein 1, Dermo-1, DERMO1MGC117334, twist homolog 2 (Drosophila), twist-related protein 2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage