COX IV Isoform 2 Antibody (1F2) | Novus Biologicals H00084701-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

COX IV Isoform 2 Antibody (1F2)

catalog :

H00084701-M01

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1F2

reactivity :

human, mouse, rat, bovine

application :

western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Douiev L, Miller C, Ruppo S, Benyamini H, Abu Libdeh B, Saada A. Upregulation of COX4-2 via HIF-1α in Mitochondrial COX4-1 Deficiency. Cells. 2021;10: pubmed publisher
Chung Y, Swietach P, Curtis M, Ball V, Robbins P, Lakhal Littleton S. Iron-Deficiency Anemia Results in Transcriptional and Metabolic Remodeling in the Heart Toward a Glycolytic Phenotype. Front Cardiovasc Med. 2020;7:616920 pubmed publisher
Madhu V, Boneski P, Silagi E, Qiu Y, Kurland I, Guntur A, et al. Hypoxic Regulation of Mitochondrial Metabolism and Mitophagy in Nucleus Pulposus Cells Is Dependent on HIF-1α-BNIP3 Axis. J Bone Miner Res. 2020;: pubmed publisher
Pajuelo Reguera D, x10c un xe1 tov xe1 K, Vrback xfd M, Pecinov xe1 A, Hou x161 t x11b k J, Mr xe1 x10d ek T, et al. Cytochrome c Oxidase Subunit 4 Isoform Exchange Results in Modulation of Oxygen Affinity. Cells. 2020;9: pubmed publisher
Sun F, Zhuo R, Ma W, Yang D, Su T, Ye L, et al. From clinic to mechanism: Proteomics-based assessment of angiogenesis in adrenal pheochromocytoma. J Cell Physiol. 2019;234:22057-22070 pubmed publisher
Purandare N, Somayajulu M, Huttemann M, Grossman L, Aras S. The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction. J Biol Chem. 2018;293:6517-6529 pubmed publisher
Schiffer T, Peleli M, Sundqvist M, Ekblom B, Lundberg J, Weitzberg E, et al. Control of human energy expenditure by cytochrome c oxidase subunit IV-2. Am J Physiol Cell Physiol. 2016;311:C452-61 pubmed publisher
Cloonan S, Glass K, Laucho Contreras M, Bhashyam A, Cervo M, Pabón M, et al. Mitochondrial iron chelation ameliorates cigarette smoke-induced bronchitis and emphysema in mice. Nat Med. 2016;22:163-74 pubmed publisher
Aras S, Pak O, Sommer N, FINLEY R, Huttemann M, Weissmann N, et al. Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2. Nucleic Acids Res. 2013;41:2255-66 pubmed publisher
Morten K, Badder L, Knowles H. Differential regulation of HIF-mediated pathways increases mitochondrial metabolism and ATP production in hypoxic osteoclasts. J Pathol. 2013;229:755-64 pubmed publisher
Huttemann M, Lee I, Gao X, Pecina P, Pecinova A, Liu J, et al. Cytochrome c oxidase subunit 4 isoform 2-knockout mice show reduced enzyme activity, airway hyporeactivity, and lung pathology. FASEB J. 2012;26:3916-30 pubmed publisher
Sundar Boyalla S, Barbara Victor M, Roemgens A, Beyer C, Arnold S. Sex- and brain region-specific role of cytochrome c oxidase in 1-methyl-4-phenylpyridinium-mediated astrocyte vulnerability. J Neurosci Res. 2011;89:2068-82 pubmed publisher
Misiak M, Singh S, Drewlo S, Beyer C, Arnold S. Brain region-specific vulnerability of astrocytes in response to 3-nitropropionic acid is mediated by cytochrome c oxidase isoform expression. Cell Tissue Res. 2010;341:83-93 pubmed publisher
Singh S, Misiak M, Beyer C, Arnold S. Brain region specificity of 3-nitropropionic acid-induced vulnerability of neurons involves cytochrome c oxidase. Neurochem Int. 2010;57:297-305 pubmed publisher

product information

brand :

Novus

master code :

H00084701-M01

SKU :

H00084701-M01

product name :

COX IV Isoform 2 Antibody (1F2)

unit size :

0.1 mg

seo description :

The COX IV Isoform 2 Antibody (1F2) - Azide and BSA Free from Novus is a mouse monoclonal antibody to COX IV Isoform 2. This antibody reacts with bovine,human,mouse,rat. The COX IV Isoform 2 Antibody (1F2) - Azide and BSA Free has been validated for the following applications: Western Blot,In vivo assay,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunoblotting.

target :

COX IV Isoform 2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1F2

conjugate :

Unconjugated

dilution :

Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting

host :

Mouse

immunogen :

MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNA
EEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRR
SNEWKT
COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Bovine,Human,Mouse,Rat

specificity :

COX4I2 - cytochrome c oxidase subunit IV isoform 2 (lung)

gene symbol :

COX4I2

accessionNumbers :

NP_115998

applications :

ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunoblotting,Western Blot,In vivo assay

USD :

499 USD

alt names :

COX IV-2, COX4, COX4-2, COX4B, COX4L2, COXIV-2, cytochrome c oxidase subunit 4 isoform 2, mitochondrial, Cytochrome c oxidase subunit IV isoform 2, cytochrome c oxidase subunit IV isoform 2 (lung), cytochrome c oxidase subunit IV-like 2, dJ857M17.2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage