product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
COX IV Isoform 2 Antibody (1F2)
catalog :
H00084701-M01
quantity :
0.1 mg
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F2
reactivity :
human, mouse, rat, bovine
application :
western blot, ELISA, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 14
Reference
Douiev L, Miller C, Ruppo S, Benyamini H, Abu Libdeh B, Saada A. Upregulation of COX4-2 via HIF-1α in Mitochondrial COX4-1 Deficiency. Cells. 2021;10: pubmed publisher
Chung Y, Swietach P, Curtis M, Ball V, Robbins P, Lakhal Littleton S. Iron-Deficiency Anemia Results in Transcriptional and Metabolic Remodeling in the Heart Toward a Glycolytic Phenotype. Front Cardiovasc Med. 2020;7:616920 pubmed publisher
Madhu V, Boneski P, Silagi E, Qiu Y, Kurland I, Guntur A, et al. Hypoxic Regulation of Mitochondrial Metabolism and Mitophagy in Nucleus Pulposus Cells Is Dependent on HIF-1α-BNIP3 Axis. J Bone Miner Res. 2020;: pubmed publisher
Pajuelo Reguera D, x10c un xe1 tov xe1 K, Vrback xfd M, Pecinov xe1 A, Hou x161 t x11b k J, Mr xe1 x10d ek T, et al. Cytochrome c Oxidase Subunit 4 Isoform Exchange Results in Modulation of Oxygen Affinity. Cells. 2020;9: pubmed publisher
Sun F, Zhuo R, Ma W, Yang D, Su T, Ye L, et al. From clinic to mechanism: Proteomics-based assessment of angiogenesis in adrenal pheochromocytoma. J Cell Physiol. 2019;234:22057-22070 pubmed publisher
Purandare N, Somayajulu M, Huttemann M, Grossman L, Aras S. The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction. J Biol Chem. 2018;293:6517-6529 pubmed publisher
Schiffer T, Peleli M, Sundqvist M, Ekblom B, Lundberg J, Weitzberg E, et al. Control of human energy expenditure by cytochrome c oxidase subunit IV-2. Am J Physiol Cell Physiol. 2016;311:C452-61 pubmed publisher
Cloonan S, Glass K, Laucho Contreras M, Bhashyam A, Cervo M, Pabón M, et al. Mitochondrial iron chelation ameliorates cigarette smoke-induced bronchitis and emphysema in mice. Nat Med. 2016;22:163-74 pubmed publisher
Aras S, Pak O, Sommer N, FINLEY R, Huttemann M, Weissmann N, et al. Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2. Nucleic Acids Res. 2013;41:2255-66 pubmed publisher
Morten K, Badder L, Knowles H. Differential regulation of HIF-mediated pathways increases mitochondrial metabolism and ATP production in hypoxic osteoclasts. J Pathol. 2013;229:755-64 pubmed publisher
Huttemann M, Lee I, Gao X, Pecina P, Pecinova A, Liu J, et al. Cytochrome c oxidase subunit 4 isoform 2-knockout mice show reduced enzyme activity, airway hyporeactivity, and lung pathology. FASEB J. 2012;26:3916-30 pubmed publisher
Sundar Boyalla S, Barbara Victor M, Roemgens A, Beyer C, Arnold S. Sex- and brain region-specific role of cytochrome c oxidase in 1-methyl-4-phenylpyridinium-mediated astrocyte vulnerability. J Neurosci Res. 2011;89:2068-82 pubmed publisher
Misiak M, Singh S, Drewlo S, Beyer C, Arnold S. Brain region-specific vulnerability of astrocytes in response to 3-nitropropionic acid is mediated by cytochrome c oxidase isoform expression. Cell Tissue Res. 2010;341:83-93 pubmed publisher
Singh S, Misiak M, Beyer C, Arnold S. Brain region specificity of 3-nitropropionic acid-induced vulnerability of neurons involves cytochrome c oxidase. Neurochem Int. 2010;57:297-305 pubmed publisher
product information
brand :
Novus
master code :
H00084701-M01
SKU :
H00084701-M01
product name :
COX IV Isoform 2 Antibody (1F2)
unit size :
0.1 mg
seo description :
The COX IV Isoform 2 Antibody (1F2) - Azide and BSA Free from Novus is a mouse monoclonal antibody to COX IV Isoform 2. This antibody reacts with bovine,human,mouse,rat. The COX IV Isoform 2 Antibody (1F2) - Azide and BSA Free has been validated for the following applications: Western Blot,In vivo assay,ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunoblotting.
target :
COX IV Isoform 2
category :
Primary Antibodies
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1F2
conjugate :
Unconjugated
dilution :
Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting
host :
Mouse
immunogen :
MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNA
EEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRR
SNEWKT
COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Bovine,Human,Mouse,Rat
specificity :
COX4I2 - cytochrome c oxidase subunit IV isoform 2 (lung)
gene symbol :
COX4I2
accessionNumbers :
NP_115998
applications :
ELISA,Immunohistochemistry,Immunoprecipitation,Immunohistochemistry-Paraffin,Immunoblotting,Western Blot,In vivo assay
USD :
499 USD
alt names :
COX IV-2, COX4, COX4-2, COX4B, COX4L2, COXIV-2, cytochrome c oxidase subunit 4 isoform 2, mitochondrial, Cytochrome c oxidase subunit IV isoform 2, cytochrome c oxidase subunit IV isoform 2 (lung), cytochrome c oxidase subunit IV-like 2, dJ857M17.2
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.