This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SESN2 Antibody (3B8)
catalog :
H00083667-M03
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B8
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
citations: 3
| Reference |
|---|
Li D, Sun T, Wu X, Chen S, Deng R, Jiang S, et al. The inhibition of autophagy sensitises colon cancer cells with wild-type p53 but not mutant p53 to topotecan treatment. PLoS ONE. 2012;7:e45058 pubmed
|
product information
brand :
Novus
master code :
H00083667-M03
SKU :
H00083667-M03
product name :
SESN2 Antibody (3B8)
description :
The SESN2 Antibody (3B8) from Novus Biologicals is a mouse monoclonal antibody to SESN2. This antibody reacts with human. The SESN2 Antibody (3B8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.
target :
SESN2
category :
Primary Antibodies
unit size :
0.1 mg
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3B8
conjugate :
Unconjugated
host :
Mouse
immunogen :
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARR
GPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDN
LAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI
MAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKL
RKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELI
QALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPP
SEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLL
RDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDM
LCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSL
IQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLR
RAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVA
CYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAAL
LYALRAITRYMT
SESN2 (AAH13304.1, 1 a.a. ~ 480 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
GPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDN
LAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI
MAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKL
RKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELI
QALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPP
SEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLL
RDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDM
LCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSL
IQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLR
RAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVA
CYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAAL
LYALRAITRYMT
SESN2 (AAH13304.1, 1 a.a. ~ 480 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
SESN2 - sestrin 2
gene symbol :
SESN2
catalog number base :
H00083667-M03
accessionNumbers :
AAH13304
applications :
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA
2020 USD :
399
2021 USD :
399 USD
alt names :
DKFZp761M0212, DKFZp761M02121, Hi95, HI95sestrin-2, SES2, SEST2hypoxia induced gene 95, sestrin 2
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
