This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
LEPRE1 Antibody (3C7)
catalog :
H00064175-M01
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C7
reactivity :
human, mouse
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
citations: 5
| Reference |
|---|
Cabral W, Chang W, Barnes A, Weis M, Scott M, Leikin S, et al. Prolyl 3-hydroxylase 1 deficiency causes a recessive metabolic bone disorder resembling lethal/severe osteogenesis imperfecta. Nat Genet. 2007;39:359-65 pubmed
|
product information
brand :
Novus
master code :
H00064175-M01
SKU :
H00064175-M01
product name :
LEPRE1 Antibody (3C7)
description :
The LEPRE1 Antibody (3C7) from Novus Biologicals is a mouse monoclonal antibody to LEPRE1. This antibody reacts with human, mouse. The LEPRE1 Antibody (3C7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.
target :
LEPRE1
category :
Primary Antibodies
unit size :
0.1 mg
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
3C7
conjugate :
Unconjugated
host :
Mouse
immunogen :
DPRVREVMNQNLAYYAAMLGEEHTRSIGPRESAKEYRQR
SLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQ
KSERETAVRISQEIGNLMKEIE
LEPRE1 (AAH15309, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
SLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQ
KSERETAVRISQEIGNLMKEIE
LEPRE1 (AAH15309, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human, Mouse
specificity :
LEPRE1 - leucine proline-enriched proteoglycan (leprecan) 1
gene symbol :
LEPRE1
catalog number base :
H00064175-M01
accessionNumbers :
AAH15309
applications :
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA
2020 USD :
399
2021 USD :
399 USD
alt names :
EC 1.14.11.7, GROS1OI8, Growth suppressor 1, leprecan, Leprecan-1, Leucine- and proline-enriched proteoglycan 1, leucine proline-enriched proteoglycan (leprecan) 1, MGC117314, P3H1LEPRECAN, prolyl 3-hydroxylase 1
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
