SAV1 Antibody (3B2) | Novus Biologicals H00060485-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SAV1 Antibody (3B2)

catalog :

H00060485-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3B2

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 9

Reference
Won G, Park S, Park J, Lee Y, Lee Y. Mammalian Hippo kinase pathway is downregulated by BCL-2 via protein degradation. Biochem Biophys Res Commun. 2019;: pubmed publisher
Ji S, Liu Q, Zhang S, Chen Q, Wang C, Zhang W, et al. FGF15 Activates Hippo Signaling to Suppress Bile Acid Metabolism and Liver Tumorigenesis. Dev Cell. 2019;48:460-474.e9 pubmed publisher
Kai T, Tsukamoto Y, Hijiya N, Tokunaga A, Nakada C, Uchida T, et al. Kidney-specific knockout of Sav1 in the mouse promotes hyperproliferation of renal tubular epithelium through suppression of the Hippo pathway. J Pathol. 2016;239:97-108 pubmed publisher
Schütte U, Bisht S, Heukamp L, Kebschull M, Florin A, Haarmann J, et al. Hippo signaling mediates proliferation, invasiveness, and metastatic potential of clear cell renal cell carcinoma. Transl Oncol. 2014;7:309-21 pubmed publisher
Yin F, Yu J, Zheng Y, Chen Q, Zhang N, Pan D. Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2. Cell. 2013;154:1342-55 pubmed publisher
Li X, Luo X, Li Z, Wang G, Xiao H, Tao D, et al. Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system. Mol Biol Rep. 2012;39:8225-30 pubmed publisher
Park B, Kim D, Won G, Jeon H, Oh B, Lee Y, et al. Mammalian ste20-like kinase and SAV1 promote 3T3-L1 adipocyte differentiation by activation of PPAR?. PLoS ONE. 2012;7:e30983 pubmed publisher
Murakami H, Mizuno T, Taniguchi T, Fujii M, Ishiguro F, Fukui T, et al. LATS2 is a tumor suppressor gene of malignant mesothelioma. Cancer Res. 2011;71:873-83 pubmed publisher
Mardin B, Lange C, Baxter J, Hardy T, Scholz S, Fry A, et al. Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction. Nat Cell Biol. 2010;12:1166-76 pubmed publisher

product information

brand :

Novus

master code :

H00060485-M02

SKU :

H00060485-M02

product name :

SAV1 Antibody (3B2)

description :

The SAV1 Antibody (3B2) from Novus Biologicals is a mouse monoclonal antibody to SAV1. This antibody reacts with human, mouse, yeast. The SAV1 Antibody (3B2) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

SAV1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3B2

conjugate :

Unconjugated

host :

Mouse

immunogen :

HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGM
LKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQ
QHGKNF
SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Yeast

specificity :

SAV1 - salvador homolog 1 (Drosophila)

gene symbol :

SAV1

catalog number base :

H00060485-M02

accessionNumbers :

NP_068590

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

45 kDa WW domain protein, hWW45, protein salvador homolog 1, salvador homolog 1 (Drosophila), SAV, WW domain-containing, WW45salvador, WWP4,1700040G09Rik

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.