Relaxin R1/LGR7 Antibody (3E3) | Novus Biologicals H00059350-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Relaxin R1/LGR7 Antibody (3E3)

catalog :

H00059350-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3.00E+03

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

citations: 8

Reference
Jelinic M, Leo C, Post Uiterweer E, Sandow S, Gooi J, Wlodek M, et al. Localization of relaxin receptors in arteries and veins, and region-specific increases in compliance and bradykinin-mediated relaxation after in vivo serelaxin treatment. FASEB J. 2014;28:275-87 pubmed publisher
Soh Y, Tiwari A, Mahendroo M, Conrad K, Parry L. Relaxin regulates hyaluronan synthesis and aquaporins in the cervix of late pregnant mice. Endocrinology. 2012;153:6054-64 pubmed publisher
Ferlin A, Menegazzo M, Gianesello L, Selice R, Foresta C. Effect of relaxin on human sperm functions. J Androl. 2012;33:474-82 pubmed publisher
Vandevoort C, Mtango N, Latham K, Stewart D. Primate preimplantation embryo is a target for relaxin during early pregnancy. Fertil Steril. 2011;96:203-7 pubmed publisher
Feng S, Agoulnik I, Truong A, Li Z, Creighton C, Kaftanovskaya E, et al. Suppression of relaxin receptor RXFP1 decreases prostate cancer growth and metastasis. Endocr Relat Cancer. 2010;17:1021-33 pubmed publisher
Vodstrcil L, Shynlova O, Verlander J, Wlodek M, Parry L. Decreased expression of the rat myometrial relaxin receptor (RXFP1) in late pregnancy is partially mediated by the presence of the conceptus. Biol Reprod. 2010;83:818-24 pubmed publisher
Ferlin A, Pepe A, Facciolli A, Gianesello L, Foresta C. Relaxin stimulates osteoclast differentiation and activation. Bone. 2010;46:504-13 pubmed publisher
Kern A, Bryant Greenwood G. Characterization of relaxin receptor (RXFP1) desensitization and internalization in primary human decidual cells and RXFP1-transfected HEK293 cells. Endocrinology. 2009;150:2419-28 pubmed publisher

product information

brand :

Novus

master code :

H00059350-M01

SKU :

H00059350-M01

product name :

Relaxin R1/LGR7 Antibody (3E3)

description :

The Relaxin R1/LGR7 Antibody (3E3) from Novus Biologicals is a mouse monoclonal antibody to Relaxin R1/LGR7. This antibody reacts with human, mouse, rat, monkey. The Relaxin R1/LGR7 Antibody (3E3) has been validated for the following applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Functional, Sandwich ELISA.

target :

Relaxin R1/LGR7

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3.00E+03

conjugate :

Unconjugated

host :

Mouse

immunogen :

WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLC
QGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDC
FKNYHDLQKLYLQNNKI
LGR7 (NP_067647, 68 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat, Monkey

specificity :

LGR7 - leucine-rich repeat-containing G protein-coupled receptor 7

gene symbol :

RXFP1

catalog number base :

H00059350-M01

accessionNumbers :

NP_067647

applications :

Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Functional, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

leucine-rich repeat-containing G protein-coupled receptor 7, Leucine-rich repeat-containing G-protein coupled receptor 7, LGR7.1, LGR7.10, LGR7LGR7.2, MGC138347, MGC142177, Relaxin family peptide receptor 1, relaxin receptor 1, relaxin/insulin-like family peptide receptor 1, RXFPR1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.