MTUS1 Antibody (1C7) | Novus Biologicals H00057509-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MTUS1 Antibody (1C7)

catalog :

H00057509-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1C7

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 8

Reference
Rodrigues Ferreira S, Nehlig A, Monchecourt C, Nasr S, Fuhrmann L, Lacroix Triki M, et al. Combinatorial expression of microtubule-associated EB1 and ATIP3 biomarkers improves breast cancer prognosis. Breast Cancer Res Treat. 2019;173:573-583 pubmed publisher
Zhao T, He Q, Liu Z, Ding X, Zhou X, Wang A. Angiotensin II type 2 receptor-interacting protein 3a suppresses proliferation, migration and invasion in tongue squamous cell carcinoma via the extracellular signal-regulated kinase-Snai2 pathway. Oncol Lett. 2016;11:340-344 pubmed
Shinoda K, Luijten I, Hasegawa Y, Hong H, Sonne S, Kim M, et al. Genetic and functional characterization of clonally derived adult human brown adipocytes. Nat Med. 2015;21:389-94 pubmed publisher
Rogler A, Hoja S, Giedl J, Ekici A, Wach S, Taubert H, et al. Loss of MTUS1/ATIP expression is associated with adverse outcome in advanced bladder carcinomas: data from a retrospective study. BMC Cancer. 2014;14:214 pubmed publisher
Guimond M, Battista M, Nikjouitavabi F, Carmel M, Barrès V, Doueik A, et al. Expression and role of the angiotensin II AT2 receptor in human prostate tissue: in search of a new therapeutic option for prostate cancer. Prostate. 2013;73:1057-68 pubmed publisher
Ding X, Zhang N, Cai Y, Li S, Zheng C, Jin Y, et al. Down-regulation of tumor suppressor MTUS1/ATIP is associated with enhanced proliferation, poor differentiation and poor prognosis in oral tongue squamous cell carcinoma. Mol Oncol. 2012;6:73-80 pubmed publisher
Melcher R, Hartmann E, Zopf W, Herterich S, Wilke P, Müller L, et al. LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability. Carcinogenesis. 2011;32:636-42 pubmed publisher
Rodrigues Ferreira S, Di Tommaso A, Dimitrov A, Cazaubon S, Gruel N, Colasson H, et al. 8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis. PLoS ONE. 2009;4:e7239 pubmed publisher

product information

brand :

Novus

master code :

H00057509-M01

SKU :

H00057509-M01

product name :

MTUS1 Antibody (1C7)

description :

The MTUS1 Antibody (1C7) from Novus Biologicals is a mouse monoclonal antibody to MTUS1. This antibody reacts with human, mouse. The MTUS1 Antibody (1C7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

MTUS1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1C7

conjugate :

Unconjugated

host :

Mouse

immunogen :

MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKAYEAS
LSEIKKGHEIEKKSLEDLLSEKQESLEKQINDLKSENDA
LNEKLKSEEQKRRAREKANLKNPQIMYLEQELESLKAVL
EIKNEKLHQQDIKLMKMGKLVDNNTALVDKLKRFQQENE
ELKARMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSM
ENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPS
PSISPR
MTUS1 (AAH33842, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse

specificity :

MTUS1 - mitochondrial tumor suppressor 1

gene symbol :

MTUS1

catalog number base :

H00057509-M01

accessionNumbers :

AAH33842

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.