NDRG2 Antibody (6A5) | Novus Biologicals H00057447-M03 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

NDRG2 Antibody (6A5)

catalog :

H00057447-M03

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6A5

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 18

Reference
Jin P, Xia F, Ma B, Li Z, Zhang G, Deng Y, et al. Spatiotemporal expression of NDRG2 in the human fetal brain. Ann Anat. 2019;221:148-155 pubmed publisher
Shen L, Qu X, Li H, Xu C, Wei M, Wang Q, et al. NDRG2 facilitates colorectal cancer differentiation through the regulation of Skp2-p21/p27 axis. Oncogene. 2018;37:1759-1774 pubmed publisher
Ma J, Liu W, Guo H, Li S, Cao W, Du X, et al. N-myc downstream-regulated gene 2 expression is associated with glucose transport and correlated with prognosis in breast carcinoma. Breast Cancer Res. 2014;16:R27 pubmed publisher
Shen L, Qu X, Ma Y, Zheng J, Chu D, Liu B, et al. Tumor suppressor NDRG2 tips the balance of oncogenic TGF-? via EMT inhibition in colorectal cancer. Oncogenesis. 2014;3:e86 pubmed publisher
Langhi C, Pedraz Cuesta E, Donate Y, Marrero P, Haro D, Rodriguez J. Regulation of N-Myc downstream regulated gene 2 by bile acids. Biochem Biophys Res Commun. 2013;434:102-9 pubmed publisher
Sun Z, Tong G, Ma N, Li J, Li X, Li S, et al. NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury. Basic Res Cardiol. 2013;108:341 pubmed publisher
Li Y, Xu N, Cai L, Gao Z, Shen L, Zhang Q, et al. NDRG2 is a novel p53-associated regulator of apoptosis in C6-originated astrocytes exposed to oxygen-glucose deprivation. PLoS ONE. 2013;8:e57130 pubmed publisher
Oh S, Kim D, Kim D, Chang H, Sohn K, Kim K, et al. NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-? production. Carcinogenesis. 2012;33:1882-8 pubmed publisher
Liu X, Niu T, Liu X, Hou W, Zhang J, Yao L. Microarray profiling of HepG2 cells ectopically expressing NDRG2. Gene. 2012;503:48-55 pubmed publisher
Li T, Hu J, He G, Li Y, Zhu C, Hou W, et al. Up-regulation of NDRG2 through nuclear factor-kappa B is required for Leydig cell apoptosis in both human and murine infertile testes. Biochim Biophys Acta. 2012;1822:301-13 pubmed publisher
Song S, Zhang S, Liu R, Yao L, Hao Y, Liao M, et al. NDRG2 down-regulation and CD24 up-regulation promote tumor aggravation and poor survival in patients with gallbladder carcinoma. Med Oncol. 2012;29:1879-85 pubmed publisher
Yang J, Zheng J, Wu L, Shi M, Zhang H, Wang X, et al. NDRG2 ameliorates hepatic fibrosis by inhibiting the TGF-?1/Smad pathway and altering the MMP2/TIMP2 ratio in rats. PLoS ONE. 2011;6:e27710 pubmed publisher
Li L, Qin X, Shi M, Miao R, Wang L, Liu X, et al. Regulation of histone acetylation by NDRG2 in glioma cells. J Neurooncol. 2012;106:485-92 pubmed publisher
Zheng J, Li Y, Yang J, Liu Q, Shi M, Zhang R, et al. NDRG2 inhibits hepatocellular carcinoma adhesion, migration and invasion by regulating CD24 expression. BMC Cancer. 2011;11:251:1-9 pubmed publisher
Li Y, Shen L, Cai L, Wang Q, Hou W, Wang F, et al. Spatial-temporal expression of NDRG2 in rat brain after focal cerebral ischemia and reperfusion. Brain Res. 2011;1382:252-8 pubmed publisher
Sun Z, Shen L, Sun X, Tong G, Sun D, Han T, et al. Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury. Histochem Cell Biol. 2011;135:27-35 pubmed publisher
Shen L, Liu X, Hou W, Yang G, Wu Y, Zhang R, et al. NDRG2 is highly expressed in pancreatic beta cells and involved in protection against lipotoxicity. Cell Mol Life Sci. 2010;67:1371-81 pubmed publisher
Shen L, Zhao Z, Wang Y, Ji S, Liu X, Liu X, et al. Immunohistochemical detection of Ndrg2 in the mouse nervous system. Neuroreport. 2008;19:927-31 pubmed publisher

product information

brand :

Novus

master code :

H00057447-M03

SKU :

H00057447-M03

product name :

NDRG2 Antibody (6A5)

description :

The NDRG2 Antibody (6A5) from Novus Biologicals is a mouse monoclonal antibody to NDRG2. This antibody reacts with human. The NDRG2 Antibody (6A5) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA, Knockdown Validated.

target :

NDRG2

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

6A5

conjugate :

Unconjugated

host :

Mouse

immunogen :

MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFT
VYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEII
QNFVRVHVDAPGMEEGAP
NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

NDRG2 - NDRG family member 2

gene symbol :

NDRG2

catalog number base :

H00057447-M03

accessionNumbers :

NP_057334

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA, Knockdown Validated

2020 USD :

399

2021 USD :

399 USD

alt names :

DKFZp781G1938, FLJ25522, KIAA1248cytoplasmic protein Ndr1, NDR1-related protein NDR2, NDRG family member 2, protein NDRG2, Protein Syld709613, syld709613 protein, SYLDN-myc downstream regulator 2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.