This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
RhoJ Antibody (1E4)
catalog :
H00057381-M01
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1.00E+04
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry
citations: 4
| Reference |
|---|
product information
brand :
Novus
master code :
H00057381-M01
SKU :
H00057381-M01
product name :
RhoJ Antibody (1E4)
description :
The RhoJ Antibody (1E4) from Novus Biologicals is a mouse monoclonal antibody to RhoJ. This antibody reacts with human. The RhoJ Antibody (1E4) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Functional, Sandwich ELISA.
target :
RhoJ
category :
Primary Antibodies
unit size :
0.1 mg
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1.00E+04
conjugate :
Unconjugated
host :
Mouse
immunogen :
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLM
SYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAG
QEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVP
ELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLT
YEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIF
HPKKKKKRCSEGHSCCSII
RHOJ (AAH62575, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
SYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAG
QEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVP
ELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLT
YEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIF
HPKKKKKRCSEGHSCCSII
RHOJ (AAH62575, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Lambda
purity :
IgG purified
species :
Human
specificity :
RHOJ - ras homolog gene family, member J
gene symbol :
RHOJ
catalog number base :
H00057381-M01
accessionNumbers :
AAH62575
applications :
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Functional, Sandwich ELISA
2020 USD :
399
2021 USD :
399 USD
alt names :
ARHJTC10B, FLJ14445, ras homolog gene family, member J, RASL7B, Ras-like protein family member 7B, RAS-like, family 7, member B, RHOI, rho-related GTP-binding protein RhoJ, Tc10-like GTP-binding protein, TC10-like Rho GTPase, TCLMGC34777
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
