This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SALL4 Antibody (6E3)
catalog :
H00057167-M03
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6.00E+03
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section
citations: 28
Reference
Terada Y, Jo N, Arakawa Y, Sakakura M, Yamada Y, Ukai T, et al. Human Pluripotent Stem Cell-Derived Tumor Model Uncovers the Embryonic Stem Cell Signature as a Key Driver in Atypical Teratoid/Rhabdoid Tumor. Cell Rep. 2019;26:2608-2621.e6 pubmed publisher
Yamada R, Horiguchi S, Onishi T, Motoi T, Hishima T. Early Gastric Cancer with Purely Enteroblastic Differentiation and No Conventional Adenocarcinoma Component. Case Rep Pathol. 2018;2018:3620293 pubmed publisher
Machado I, Yoshida A, Morales M, Abrahão Machado L, Navarro S, Cruz J, et al. Review with novel markers facilitates precise categorization of 41 cases of diagnostically challenging, "undifferentiated small round cell tumors". A clinicopathologic, immunophenotypic and molecular analysis. Ann Diagn Pathol. 2018;34:1-12 pubmed publisher
Fujimoto M, Matsuzaki I, Nishino M, Iwahashi Y, Warigaya K, Kojima F, et al. HER2 is frequently overexpressed in hepatoid adenocarcinoma and gastric carcinoma with enteroblastic differentiation: a comparison of 35 cases to 334 gastric carcinomas of other histological types. J Clin Pathol. 2018;71:600-607 pubmed publisher
Shi H, Xu X, Zhang B, Xu J, Pan Z, Gong A, et al. 3,3'-Diindolylmethane stimulates exosomal Wnt11 autocrine signaling in human umbilical cord mesenchymal stem cells to enhance wound healing. Theranostics. 2017;7:1674-1688 pubmed publisher
Yoshida A, Kobayashi E, Kubo T, Kodaira M, Motoi T, Motoi N, et al. Clinicopathological and molecular characterization of SMARCA4-deficient thoracic sarcomas with comparison to potentially related entities. Mod Pathol. 2017;30:797-809 pubmed publisher
Matsumoto K, Ueyama H, Matsumoto K, Akazawa Y, Komori H, Takeda T, et al. Clinicopathological features of alpha-fetoprotein producing early gastric cancer with enteroblastic differentiation. World J Gastroenterol. 2016;22:8203-10 pubmed publisher
Bie Q, Sun C, Gong A, Li C, Su Z, Zheng D, et al. Non-tumor tissue derived interleukin-17B activates IL-17RB/AKT/β-catenin pathway to enhance the stemness of gastric cancer. Sci Rep. 2016;6:25447 pubmed publisher
Kilic E, Tennstedt P, Högner A, Lebok P, Sauter G, Bokemeyer C, et al. The zinc-finger transcription factor SALL4 is frequently expressed in human cancers: association with clinical outcome in squamous cell carcinoma but not in adenocarcinoma of the esophagus. Virchows Arch. 2016;468:483-92 pubmed publisher
Chapman K, Medrano G, Chaudhary J, Hamra F. NRG1 and KITL Signal Downstream of Retinoic Acid in the Germline to Support Soma-Free Syncytial Growth of Differentiating Spermatogonia. Cell Death Discov. 2015;1: pubmed
Shibahara J, Ando S, Hayashi A, Sakamoto Y, Hesegawa K, Kokudo N, et al. Clinicopathologic characteristics of SALL4-immunopositive hepatocellular carcinoma. Springerplus. 2014;3:721 pubmed publisher
Tajima S, Koda K. Germinoma with an extensive rhabdoid cell component centered at the corpus callosum. Med Mol Morphol. 2017;50:52-58 pubmed publisher
Murakami T, Yao T, Mitomi H, Morimoto T, Ueyama H, Matsumoto K, et al. Clinicopathologic and immunohistochemical characteristics of gastric adenocarcinoma with enteroblastic differentiation: a study of 29 cases. Gastric Cancer. 2016;19:498-507 pubmed publisher
Kohashi K, Yamada Y, Hotokebuchi Y, Yamamoto H, Taguchi T, Iwamoto Y, et al. ERG and SALL4 expressions in SMARCB1/INI1-deficient tumors: a useful tool for distinguishing epithelioid sarcoma from malignant rhabdoid tumor. Hum Pathol. 2015;46:225-30 pubmed publisher
Yoshida A, Asano N, Kawai A, Kawamoto H, Nakazawa A, Kishimoto H, et al. Differential SALL4 immunoexpression in malignant rhabdoid tumours and epithelioid sarcomas. Histopathology. 2015;66:252-61 pubmed publisher
Osada M, Aishima S, Hirahashi M, Takizawa N, Takahashi S, Nakamura K, et al. Combination of hepatocellular markers is useful for prognostication in gastric hepatoid adenocarcinoma. Hum Pathol. 2014;45:1243-50 pubmed publisher
Liu L, Souto J, Liao W, Jiang Y, Li Y, Nishinakamura R, et al. Histone lysine-specific demethylase 1 (LSD1) protein is involved in Sal-like protein 4 (SALL4)-mediated transcriptional repression in hematopoietic stem cells. J Biol Chem. 2013;288:34719-28 pubmed publisher
Fujimoto M, Sumiyoshi S, Yoshizawa A, Sonobe M, Kobayashi M, Moriyoshi K, et al. SALL4 immunohistochemistry in non-small-cell lung carcinomas. Histopathology. 2014;64:309-11 pubmed publisher
Zeng S, Yamashita T, Kondo M, Nio K, Hayashi T, Hara Y, et al. The transcription factor SALL4 regulates stemness of EpCAM-positive hepatocellular carcinoma. J Hepatol. 2014;60:127-34 pubmed publisher
Ota Y, Iihara K, Ryu T, Morikawa T, Fukayama M. Metastatic seminomas in lymph nodes: CD10 immunoreactivity can be a pitfall of differential diagnosis. Int J Clin Exp Pathol. 2013;6:498-502 pubmed
Ikeda H, Sato Y, Yoneda N, Harada K, Sasaki M, Kitamura S, et al. ?-Fetoprotein-producing gastric carcinoma and combined hepatocellular and cholangiocarcinoma show similar morphology but different histogenesis with respect to SALL4 expression. Hum Pathol. 2012;43:1955-63 pubmed publisher
Iwamoto N, Ishida M, Yoshida K, Kagotani A, Iwai M, Okabe H. Mediastinal seminoma: a case report with special emphasis on SALL4 as a new immunocytochemical marker. Diagn Cytopathol. 2013;41:821-4 pubmed publisher
Meguro S, Yasuda M. ?-Fetoprotein-producing ovarian tumor in a postmenopausal woman with germ cell differentiation. Ann Diagn Pathol. 2013;17:140-4 pubmed publisher
Clark P, Polosukhina D, Love H, Correa H, Coffin C, Perlman E, et al. ?-Catenin and K-RAS synergize to form primitive renal epithelial tumors with features of epithelial Wilms' tumors. Am J Pathol. 2011;179:3045-55 pubmed publisher
Deisch J, Raisanen J, Rakheja D. Immunoexpression of SALL4 in Wilms tumors and developing kidney. Pathol Oncol Res. 2011;17:639-44 pubmed publisher
Sangoi A, Karamchandani J, Lane B, Higgins J, Rouse R, Brooks J, et al. Specificity of brachyury in the distinction of chordoma from clear cell renal cell carcinoma and germ cell tumors: a study of 305 cases. Mod Pathol. 2011;24:425-9 pubmed publisher
Forte A, Schettino M, Finicelli M, Cipollaro M, Colacurci N, Cobellis L, et al. Expression pattern of stemness-related genes in human endometrial and endometriotic tissues. Mol Med. 2009;15:392-401 pubmed publisher
Cauffman G, De Rycke M, Sermon K, Liebaers I, Van de Velde H. Markers that define stemness in ESC are unable to identify the totipotent cells in human preimplantation embryos. Hum Reprod. 2009;24:63-70 pubmed publisher
product information
brand :
Novus
master code :
H00057167-M03
SKU :
H00057167-M03
product name :
SALL4 Antibody (6E3)
description :
The SALL4 Antibody (6E3) from Novus Biologicals is a mouse monoclonal antibody to SALL4. This antibody reacts with human, mouse, rat. The SALL4 Antibody (6E3) has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.
target :
SALL4
category :
Primary Antibodies
unit size :
0.1 mg
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
6.00E+03
conjugate :
Unconjugated
host :
Mouse
immunogen :
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQS
GGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPS
ATDGVPKHQFPHFLEENKIAVS
SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG1 Kappa
purity :
Protein A purified
species :
Human, Mouse, Rat
specificity :
SALL4 (6E3)
gene symbol :
SALL4
catalog number base :
H00057167-M03
accessionNumbers :
NP_065169
applications :
Western Blot, Chromatin Immunoprecipitation, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA
2020 USD :
399
2021 USD :
399 USD
alt names :
dJ1112F19.1, DRRS, HSAL4, MGC133050, sal-like 4 (Drosophila), sal-like protein 4, Zinc finger protein 797, Zinc finger protein SALL4, ZNF797sal (Drosophila)-like 4
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information
Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.