SMURF1 Antibody (1D7) | Novus Biologicals H00057154-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SMURF1 Antibody (1D7)

catalog :

H00057154-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1D7

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 7

Reference
Murakami K, Etlinger J. Role of SMURF1 ubiquitin ligase in BMP receptor trafficking and signaling. Cell Signal. 2019;54:139-149 pubmed publisher
Zhu K, Tang Y, Xu X, Dang H, Tang L, Wang X, et al. Non-proteolytic ubiquitin modification of PPARγ by Smurf1 protects the liver from steatosis. PLoS Biol. 2018;16:e3000091 pubmed publisher
Tang Y, Tang L, Xu X, Li C, Deng C, Zhang Y. Generation of Smurf2 Conditional Knockout Mice. Int J Biol Sci. 2018;14:542-548 pubmed publisher
BARNES J, Kucera E, Tian L, Mellor N, Dvorina N, Baldwin W, et al. Bone Morphogenic Protein Type 2 Receptor Mutation-Independent Mechanisms of Disrupted Bone Morphogenetic Protein Signaling in Idiopathic Pulmonary Arterial Hypertension. Am J Respir Cell Mol Biol. 2016;55:564-575 pubmed
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, et al. Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer. J Biol Chem. 2013;288:33667-81 pubmed publisher
Du J, Hagos E, Nandan M, Bialkowska A, Yu B, Yang V. The E3 ubiquitin ligase SMAD ubiquitination regulatory factor 2 negatively regulates Krüppel-like factor 5 protein. J Biol Chem. 2011;286:40354-64 pubmed publisher
Murakami K, Mathew R, Huang J, Farahani R, Peng H, Olson S, et al. Smurf1 ubiquitin ligase causes downregulation of BMP receptors and is induced in monocrotaline and hypoxia models of pulmonary arterial hypertension. Exp Biol Med (Maywood). 2010;235:805-13 pubmed publisher

product information

brand :

Novus

master code :

H00057154-M01

SKU :

H00057154-M01

product name :

SMURF1 Antibody (1D7)

description :

The SMURF1 Antibody (1D7) from Novus Biologicals is a mouse monoclonal antibody to SMURF1. This antibody reacts with human, mouse, rat. The SMURF1 Antibody (1D7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

SMURF1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1D7

conjugate :

Unconjugated

host :

Mouse

immunogen :

DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQ
DQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQ
RTTVQGQVYFLHTQTGVSTWHDPRIP
SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

SMURF1 (1D7)

gene symbol :

SMURF1

catalog number base :

H00057154-M01

accessionNumbers :

NP_065162

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

E3 ubiquitin ligase SMURF1, EC 6.3.2, EC 6.3.2.-, hSMURF1, KIAA1625E3 ubiquitin-protein ligase SMURF1, SMAD specific E3 ubiquitin protein ligase 1, SMAD ubiquitination regulatory factor 1, Smad-specific E3 ubiquitin ligase 1, SMAD-specific E3 ubiquitin-protein ligase 1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.