Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) | Novus Biologicals H00057016-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)

catalog :

H00057016-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1A6

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 11

Reference
Phadke G, Kaushal A, Tolan D, Hahn K, Jensen T, Bjornstad P, et al. Osmotic Nephrosis and Acute Kidney Injury Associated With SGLT2 Inhibitor Use: A Case Report. Am J Kidney Dis. 2020;76:144-147 pubmed publisher
Kitakaze T, Makiyama A, Samukawa Y, Jiang S, Yamashita Y, Ashida H. A physiological concentration of luteolin induces phase II drug-metabolizing enzymes through the ERK1/2 signaling pathway in HepG2 cells. Arch Biochem Biophys. 2019;663:151-159 pubmed publisher
Park S, Kim J, Ko E, Kim J, Park M, Kim M, et al. Resistance to gefitinib and cross-resistance to irreversible EGFR-TKIs mediated by disruption of the Keap1-Nrf2 pathway in human lung cancer cells. FASEB J. 2018;:fj201800011R pubmed publisher
Connor J, Esbona K, Matkowskyj K. AKR1B10 expression by immunohistochemistry in surgical resections and fine needle aspiration cytology material in patients with cystic pancreatic lesions; potential for improved nonoperative diagnosis. Hum Pathol. 2017;70:77-83 pubmed publisher
Berard A, Coombs K, Severini A. Quantification of the host response proteome after herpes simplex virus type 1 infection. J Proteome Res. 2015;14:2121-42 pubmed publisher
Matkowskyj K, Bai H, Liao J, Zhang W, Li H, Rao S, et al. Aldoketoreductase family 1B10 (AKR1B10) as a biomarker to distinguish hepatocellular carcinoma from benign liver lesions. Hum Pathol. 2014;45:834-43 pubmed publisher
Nelson A, Pillay N, Henderson S, Presneau N, Tirabosco R, Halai D, et al. An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma. J Pathol. 2012;228:274-85 pubmed publisher
Chung Y, Matkowskyj K, Li H, Bai H, Zhang W, Tsao M, et al. Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma. Mod Pathol. 2012;25:758-66 pubmed publisher
Schmitz K, Sotiropoulos G, Baba H, Schmid K, Müller D, Paul A, et al. AKR1B10 expression is associated with less aggressive hepatocellular carcinoma: a clinicopathological study of 168 cases. Liver Int. 2011;31:810-6 pubmed publisher
Bains O, Grigliatti T, Reid R, Riggs K. Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin. J Pharmacol Exp Ther. 2010;335:533-45 pubmed publisher
Satow R, Shitashige M, Kanai Y, Takeshita F, Ojima H, Jigami T, et al. Combined functional genome survey of therapeutic targets for hepatocellular carcinoma. Clin Cancer Res. 2010;16:2518-28 pubmed publisher

product information

brand :

Novus

master code :

H00057016-M01

SKU :

H00057016-M01

product name :

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)

description :

The Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) from Novus Biologicals is a mouse monoclonal antibody to Aldo-keto Reductase 1B10/AKR1B10. This antibody reacts with human. The Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

Aldo-keto Reductase 1B10/AKR1B10

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

1A6

conjugate :

Unconjugated

host :

Mouse

immunogen :

VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQ
GFKSGDDLFPKDDKGNAIGGKATFLDAWE
AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human

specificity :

AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)

gene symbol :

AKR1B10

catalog number base :

H00057016-M01

accessionNumbers :

NP_064695

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

AKR1B11, AKR1B12, aldo-keto reductase family 1 member B10, aldo-keto reductase family 1, member B10 (aldose reductase), aldo-keto reductase family 1, member B11 (aldose reductase-like), Aldose reductase-like, aldose reductase-like 1, aldose reductase-like peptide, Aldose reductase-related protein, ALDRLn, ARL1, ARL-1SI reductase, ARP, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.21, hARP, HIS, HSI, MGC14103, Small intestine reductase

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.