TMEPAI Antibody (2A12) | Novus Biologicals H00056937-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TMEPAI Antibody (2A12)

catalog :

H00056937-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2A12

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 10

Reference
Kumar P, Sharad S, Petrovics G, Mohamed A, Dobi A, Sreenath T, et al. Loss of miR-449a in ERG-associated prostate cancer promotes the invasive phenotype by inducing SIRT1. Oncotarget. 2016;7:22791-806 pubmed publisher
Li H, Mohamed A, Sharad S, Umeda E, Song Y, Young D, et al. Silencing of PMEPA1 accelerates the growth of prostate cancer cells through AR, NEDD4 and PTEN. Oncotarget. 2015;6:15137-49 pubmed
Singha P, Pandeswara S, Geng H, Lan R, Venkatachalam M, Saikumar P. TGF-Î² induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer. Genes Cancer. 2014;5:320-36 pubmed
O Hainmhire E, Quartuccio S, Cheng W, Ahmed R, King S, Burdette J. Mutation or loss of p53 differentially modifies TGF? action in ovarian cancer. PLoS ONE. 2014;9:e89553 pubmed publisher
Hu Y, He K, Wang D, Yuan X, Liu Y, Ji H, et al. TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways. Carcinogenesis. 2013;34:1764-72 pubmed publisher
Costea D, Hills A, Osman A, Thurlow J, Kalna G, Huang X, et al. Identification of two distinct carcinoma-associated fibroblast subtypes with differential tumor-promoting abilities in oral squamous cell carcinoma. Cancer Res. 2013;73:3888-901 pubmed publisher
Singha P, Yeh I, Venkatachalam M, Saikumar P. Transforming growth factor-beta (TGF-beta)-inducible gene TMEPAI converts TGF-beta from a tumor suppressor to a tumor promoter in breast cancer. Cancer Res. 2010;70:6377-83 pubmed publisher
Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, et al. TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling. Mol Cell. 2010;37:123-34 pubmed publisher
Li H, Xu L, Masuda K, Raymundo E, McLeod D, Dobi A, et al. A feedback loop between the androgen receptor and a NEDD4-binding protein, PMEPA1, in prostate cancer cells. J Biol Chem. 2008;283:28988-95 pubmed publisher
Hirokawa Y, Takagi A, Uchida K, Kozuka Y, Yoneda M, Watanabe M, et al. High level expression of STAG1/PMEPA1 in an androgen-independent prostate cancer PC3 subclone. Cell Mol Biol Lett. 2007;12:370-7 pubmed publisher

product information

brand :

Novus

master code :

H00056937-M01

SKU :

H00056937-M01

product name :

TMEPAI Antibody (2A12)

description :

The TMEPAI Antibody (2A12) from Novus Biologicals is a mouse monoclonal antibody to TMEPAI. This antibody reacts with human, mouse, rat. The TMEPAI Antibody (2A12) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

TMEPAI

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2A12

conjugate :

Unconjugated

host :

Mouse

immunogen :

NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRME
GPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTH
IAPLESAAIWSKEKDKQKGHPL
TMEPAI (AAH15918, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

TMEPAI - transmembrane, prostate androgen induced RNA

gene symbol :

PMEPA1

catalog number base :

H00056937-M01

accessionNumbers :

AAH15918

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

prostate transmembrane protein, androgen induced 1, Solid tumor-associated 1 protein, STAG1prostate androgen induced RNA, transmembrane prostate androgen-induced protein

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.