RAD18 Antibody (3H7) | Novus Biologicals H00056852-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

RAD18 Antibody (3H7)

catalog :

H00056852-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3H7

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

citations: 13

Reference
Lim K, Li H, Roberts E, Gaudiano E, Clairmont C, Sambel L, et al. USP1 Is Required for Replication Fork Protection in BRCA1-Deficient Tumors. Mol Cell. 2018;72:925-941.e4 pubmed publisher
Kanu N, Zhang T, Burrell R, Chakraborty A, Cronshaw J, DaCosta C, et al. RAD18, WRNIP1 and ATMIN promote ATM signalling in response to replication stress. Oncogene. 2016;35:4009-19 pubmed publisher
Kile A, Chavez D, Bacal J, Eldirany S, Korzhnev D, Bezsonova I, et al. HLTF's Ancient HIRAN Domain Binds 3' DNA Ends to Drive Replication Fork Reversal. Mol Cell. 2015;58:1090-100 pubmed publisher
Sy S, Jiang J, O W, Deng Y, Huen M. The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks. Nucleic Acids Res. 2013;41:8572-80 pubmed publisher
Ghosal G, Leung J, Nair B, Fong K, Chen J. Proliferating cell nuclear antigen (PCNA)-binding protein C1orf124 is a regulator of translesion synthesis. J Biol Chem. 2012;287:34225-33 pubmed publisher
Huehls A, Wagner J, Huntoon C, Karnitz L. Identification of DNA repair pathways that affect the survival of ovarian cancer cells treated with a poly(ADP-ribose) polymerase inhibitor in a novel drug combination. Mol Pharmacol. 2012;82:767-76 pubmed
Panier S, Ichijima Y, Fradet Turcotte A, Leung C, Kaustov L, Arrowsmith C, et al. Tandem protein interaction modules organize the ubiquitin-dependent response to DNA double-strand breaks. Mol Cell. 2012;47:383-95 pubmed publisher
Kato D, Waki M, Umezawa M, Aoki Y, Utsugi T, Ohtsu M, et al. Phosphorylation of human INO80 is involved in DNA damage tolerance. Biochem Biophys Res Commun. 2012;417:433-8 pubmed publisher
Wong R, Aguissa Touré A, Wani A, Khosravi S, Martinka M, Martinka M, et al. Elevated expression of Rad18 regulates melanoma cell proliferation. Pigment Cell Melanoma Res. 2012;25:213-8 pubmed publisher
Yanagihara H, Kobayashi J, Tateishi S, Kato A, Matsuura S, Tauchi H, et al. NBS1 recruits RAD18 via a RAD6-like domain and regulates Pol ?-dependent translesion DNA synthesis. Mol Cell. 2011;43:788-97 pubmed publisher
Wong R, Lin H, Khosravi S, Piche B, Jafarnejad S, Chen D, et al. Tumour suppressor ING1b maintains genomic stability upon replication stress. Nucleic Acids Res. 2011;39:3632-42 pubmed publisher
Kobayashi J, Okui M, Asaithamby A, Burma S, Chen B, Tanimoto K, et al. WRN participates in translesion synthesis pathway through interaction with NBS1. Mech Ageing Dev. 2010;131:436-44 pubmed publisher
Hicks J, Chute C, Paulsen M, Ragland R, Howlett N, Gueranger Q, et al. Differential roles for DNA polymerases eta, zeta, and REV1 in lesion bypass of intrastrand versus interstrand DNA cross-links. Mol Cell Biol. 2010;30:1217-30 pubmed publisher

product information

brand :

Novus

master code :

H00056852-M01

SKU :

H00056852-M01

product name :

RAD18 Antibody (3H7)

description :

The RAD18 Antibody (3H7) from Novus Biologicals is a mouse monoclonal antibody to RAD18. This antibody reacts with human, mouse, rat. The RAD18 Antibody (3H7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA.

target :

RAD18

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3H7

conjugate :

Unconjugated

host :

Mouse

immunogen :

EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQK
TVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDS
PEELEPDREEDSSSCIDIQEV
RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

RAD18 - RAD18 homolog (S. cerevisiae)

gene symbol :

RAD18

catalog number base :

H00056852-M01

accessionNumbers :

NP_064550

applications :

Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

EC 6.3.2.-, hHR18, hRAD18, postreplication repair protein hRAD18p, Postreplication repair protein RAD18, RAD18 homolog (S. cerevisiae), RAD18, S. cerevisiae, homolog, RING finger protein 73, RNF73E3 ubiquitin-protein ligase RAD18

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.