Mitofusin 1 Antibody (3C9) | Novus Biologicals H00055669-M04 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Mitofusin 1 Antibody (3C9)

catalog :

H00055669-M04

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3C9

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry, immunoprecipitation, flow cytometry

citations: 26

Reference
Zhao Y, Sun X, Hu D, Prosdocimo D, Hoppel C, Jain M, et al. ATAD3A oligomerization causes neurodegeneration by coupling mitochondrial fragmentation and bioenergetics defects. Nat Commun. 2019;10:1371 pubmed publisher
Zhou Q, Li H, Li Y, Tan M, Fan S, Cao C, et al. Inhibiting neddylation modification alters mitochondrial morphology and reprograms energy metabolism in cancer cells. JCI Insight. 2019;4: pubmed publisher
Ferreira J, Campos J, Qvit N, Qi X, Bozi L, Bechara L, et al. A selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats. Nat Commun. 2019;10:329 pubmed publisher
Ishikawa K, Yamamoto S, Hattori S, Nishimura N, Tani H, Mito T, et al. Acquired Expression of Mutant Mitofusin 2 Causes Progressive Neurodegeneration and Abnormal Behavior. J Neurosci. 2019;39:1588-1604 pubmed publisher
Wei Q, Sun H, Song S, Liu Y, Liu P, Livingston M, et al. MicroRNA-668 represses MTP18 to preserve mitochondrial dynamics in ischemic acute kidney injury. J Clin Invest. 2018;128:5448-5464 pubmed publisher
Furuya N, Kakuta S, Sumiyoshi K, Ando M, Nonaka R, Suzuki A, et al. NDP52 interacts with mitochondrial RNA poly(A) polymerase to promote mitophagy. EMBO Rep. 2018;19: pubmed publisher
Vukotic M, Nolte H, König T, Saita S, Ananjew M, Kruger M, et al. Acylglycerol Kinase Mutated in Sengers Syndrome Is a Subunit of the TIM22 Protein Translocase in Mitochondria. Mol Cell. 2017;67:471-483.e7 pubmed publisher
Guedouari H, Daigle T, Scorrano L, Hébert Chatelain E. Sirtuin 5 protects mitochondria from fragmentation and degradation during starvation. Biochim Biophys Acta Mol Cell Res. 2017;1864:169-176 pubmed publisher
Chen M, Chen Z, Wang Y, Tan Z, Zhu C, Li Y, et al. Mitophagy receptor FUNDC1 regulates mitochondrial dynamics and mitophagy. Autophagy. 2016;12:689-702 pubmed publisher
Shiba Fukushima K, Inoshita T, Hattori N, Imai Y. Lysine 63-linked polyubiquitination is dispensable for Parkin-mediated mitophagy. J Biol Chem. 2014;289:33131-6 pubmed publisher
Baba T, Kashiwagi Y, Arimitsu N, Kogure T, Edo A, Maruyama T, et al. Phosphatidic acid (PA)-preferring phospholipase A1 regulates mitochondrial dynamics. J Biol Chem. 2014;289:11497-511 pubmed publisher
Yue W, Chen Z, Liu H, Yan C, Chen M, Feng D, et al. A small natural molecule promotes mitochondrial fusion through inhibition of the deubiquitinase USP30. Cell Res. 2014;24:482-96 pubmed publisher
Furuya N, Ikeda S, Sato S, Soma S, Ezaki J, Oliva Trejo J, et al. PARK2/Parkin-mediated mitochondrial clearance contributes to proteasome activation during slow-twitch muscle atrophy via NFE2L1 nuclear translocation. Autophagy. 2014;10:631-41 pubmed publisher
Fülöp L, Rajki A, Katona D, Szanda G, Spät A. Extramitochondrial OPA1 and adrenocortical function. Mol Cell Endocrinol. 2013;381:70-9 pubmed publisher
Ban Ishihara R, Ishihara T, Sasaki N, Mihara K, Ishihara N. Dynamics of nucleoid structure regulated by mitochondrial fission contributes to cristae reformation and release of cytochrome c. Proc Natl Acad Sci U S A. 2013;110:11863-8 pubmed publisher
Russell A, Lamon S, Boon H, Wada S, Güller I, Brown E, et al. Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training. J Physiol. 2013;591:4637-53 pubmed publisher
Goller T, Seibold U, Kremmer E, Voos W, Kolanus W. Atad3 function is essential for early post-implantation development in the mouse. PLoS ONE. 2013;8:e54799 pubmed publisher
Takamura H, Koyama Y, Matsuzaki S, Yamada K, Hattori T, Miyata S, et al. TRAP1 controls mitochondrial fusion/fission balance through Drp1 and Mff expression. PLoS ONE. 2012;7:e51912 pubmed publisher
Shiba Fukushima K, Imai Y, Yoshida S, Ishihama Y, Kanao T, Sato S, et al. PINK1-mediated phosphorylation of the Parkin ubiquitin-like domain primes mitochondrial translocation of Parkin and regulates mitophagy. Sci Rep. 2012;2:1002 pubmed publisher
Lin H, Lai R, Lin S, Lin R, Wang M, Lin C, et al. Suppressor of cytokine signaling 6 (SOCS6) promotes mitochondrial fission via regulating DRP1 translocation. Cell Death Differ. 2013;20:139-53 pubmed publisher
Chung S, Calafiore M, Plane J, Pleasure D, Deng W. Apoptosis inducing factor deficiency causes reduced mitofusion 1 expression and patterned Purkinje cell degeneration. Neurobiol Dis. 2011;41:445-57 pubmed publisher
Bui M, Gilady S, Fitzsimmons R, Benson M, Lynes E, Gesson K, et al. Rab32 modulates apoptosis onset and mitochondria-associated membrane (MAM) properties. J Biol Chem. 2010;285:31590-602 pubmed publisher
Wang X, Su B, Lee H, Li X, Perry G, Smith M, et al. Impaired balance of mitochondrial fission and fusion in Alzheimer's disease. J Neurosci. 2009;29:9090-103 pubmed publisher
Wang H, Lim P, Karbowski M, Monteiro M. Effects of overexpression of huntingtin proteins on mitochondrial integrity. Hum Mol Genet. 2009;18:737-52 pubmed publisher
Holloway G, Perry C, Thrush A, Heigenhauser G, Dyck D, Bonen A, et al. PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein. Am J Physiol Endocrinol Metab. 2008;294:E1060-9 pubmed publisher
Zanna C, Ghelli A, Porcelli A, Karbowski M, Youle R, Schimpf S, et al. OPA1 mutations associated with dominant optic atrophy impair oxidative phosphorylation and mitochondrial fusion. Brain. 2008;131:352-67 pubmed publisher

product information

brand :

Novus

master code :

H00055669-M04

SKU :

H00055669-M04

product name :

Mitofusin 1 Antibody (3C9)

description :

The Mitofusin 1 Antibody (3C9) from Novus Biologicals is a mouse monoclonal antibody to Mitofusin 1. This antibody reacts with human, mouse, rat. The Mitofusin 1 Antibody (3C9) has been validated for the following applications: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, RNA Inhibition, Sandwich ELISA.

target :

Mitofusin 1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3C9

conjugate :

Unconjugated

host :

Mouse

immunogen :

MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEAT
YKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKV
AFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEG
TDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGC
LVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKF
CLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFI
LNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNA
LEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHA
RLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATV
KNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLL
TLDVKKKIKEVTEEVANKVSCAMTDEICRLSVLVDEFCS
EFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNAL
VLQTQQEIIENLKPLLPAGIQDKLHTLIPCKKFDLSYNL
NYHKLCSDFQEDIVFRFSLGWSSLVHRFLGPRNAQRVLL
GLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLV
TGLASVTSRTSMGIIIVGGVIWKTIGWKLLSVSLTMYGA
LYLYERLSWTTHAKERAFKQQFVNYATEKLRMIVSSTSA
NCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEI
DQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES
MFN1 (AAH40557, 1 a.a. ~ 741 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

MFN1 - mitofusin 1. This antibody may cross react with MFN2 protein.

gene symbol :

MFN1

catalog number base :

H00055669-M04

accessionNumbers :

AAH40557

applications :

Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, RNA Inhibition, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

DKFZp762F247, EC 3.6.5, EC 3.6.5.-, FLJ20693, Fzo homolog, hfzo1, hfzo2, MGC41806, mitochondrial transmembrane GTPase Fzo-1, mitochondrial transmembrane GTPase FZO-2, mitofusin 1, mitofusin-1, putative transmembrane GTPase, Transmembrane GTPase MFN1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.