FBXW7/Cdc4 Antibody (3D1) | Novus Biologicals H00055294-M02 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FBXW7/Cdc4 Antibody (3D1)

catalog :

H00055294-M02

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

3D1

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunohistochemistry - paraffin section

citations: 9

Reference
Koga Y, Iwatsuki M, Yamashita K, Kiyozumi Y, Kurashige J, Masuda T, et al. The role of FBXW7, a cell-cycle regulator, as a predictive marker of recurrence of gastrointestinal stromal tumors. Gastric Cancer. 2019;: pubmed publisher
Arita H, Nagata M, Yoshida R, Matsuoka Y, Hirosue A, Kawahara K, et al. FBXW7 expression affects the response to chemoradiotherapy and overall survival among patients with oral squamous cell carcinoma: A single-center retrospective study. Tumour Biol. 2017;39:1010428317731771 pubmed publisher
Yao S, Xu F, Chen Y, Ge Y, Zhang F, Huang H, et al. Fbw7 regulates apoptosis in activated B-cell like diffuse large B-cell lymphoma by targeting Stat3 for ubiquitylation and degradation. J Exp Clin Cancer Res. 2017;36:10 pubmed publisher
Hua J, Ding T, Yang L. Dysfunction of microRNA-32 regulates ubiquitin ligase FBXW7 in multiple myeloma disease. Onco Targets Ther. 2016;9:6573-6579 pubmed
Yumimoto K, Akiyoshi S, Ueo H, Sagara Y, Onoyama I, Ueo H, et al. F-box protein FBXW7 inhibits cancer metastasis in a non-cell-autonomous manner. J Clin Invest. 2015;125:621-35 pubmed publisher
Yang S, Wang B, Humphries F, Hogan A, O Shea D, Moynagh P. The E3 ubiquitin ligase Pellino3 protects against obesity-induced inflammation and insulin resistance. Immunity. 2014;41:973-87 pubmed publisher
Lin D, Hao J, Nagata Y, Xu L, Shang L, Meng X, et al. Genomic and molecular characterization of esophageal squamous cell carcinoma. Nat Genet. 2014;46:467-73 pubmed publisher
Yokobori T, Yokoyama Y, Mogi A, Endoh H, Altan B, Kosaka T, et al. FBXW7 mediates chemotherapeutic sensitivity and prognosis in NSCLCs. Mol Cancer Res. 2014;12:32-7 pubmed publisher
Enchev R, Scott D, da Fonseca P, Schreiber A, Monda J, Schulman B, et al. Structural basis for a reciprocal regulation between SCF and CSN. Cell Rep. 2012;2:616-27 pubmed publisher

product information

brand :

Novus

master code :

H00055294-M02

SKU :

H00055294-M02

product name :

FBXW7/Cdc4 Antibody (3D1)

description :

The FBXW7/Cdc4 Antibody (3D1) from Novus Biologicals is a mouse monoclonal antibody to FBXW7/Cdc4. This antibody reacts with human. The FBXW7/Cdc4 Antibody (3D1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA.

target :

FBXW7/Cdc4

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

3D1

conjugate :

Unconjugated

host :

Mouse

immunogen :

ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFV
ITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIR
ASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human

specificity :

FBXW7 - F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila)

gene symbol :

FBXW7

catalog number base :

H00055294-M02

accessionNumbers :

NP_361014

applications :

Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

AGOFBXO30, Archipelago homolog, archipelago, Drosophila, homolog of, CDC4FLJ16457, F-box and WD repeat domain containing 7, F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), F-box and WD-40 domain-containing protein 7, F-box protein FBW7, F-box protein FBX30, F-box protein SEL-10, F-box/WD repeat-containing protein 7, FBW7hCdc4, FBX30FLJ11071, FBXW6, hAgo, homolog of C elegans sel-10, SEL-10DKFZp686F23254, SEL10FBW6

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.