Rhot1 Antibody (4H4) | Novus Biologicals H00055288-M01 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Rhot1 Antibody (4H4)

catalog :

H00055288-M01

quantity :

0.1 mg

price :

399 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4H4

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry

citations: 8

Reference
Palomo G, Granatiero V, Kawamata H, Konràd C, Kim M, Arreguin A, et al. Parkin is a disease modifier in the mutant SOD1 mouse model of ALS. EMBO Mol Med. 2018;10: pubmed publisher
Wang L, Gao J, Liu J, Siedlak S, Torres S, Fujioka H, et al. Mitofusin 2 Regulates Axonal Transport of Calpastatin to Prevent Neuromuscular Synaptic Elimination in Skeletal Muscles. Cell Metab. 2018;28:400-414.e8 pubmed publisher
Lee C, Chin L, Li L. Hypertonia-linked protein Trak1 functions with mitofusins to promote mitochondrial tethering and fusion. Protein Cell. 2018;9:693-716 pubmed publisher
Fiesel F, James E, Hudec R, Springer W. Mitochondrial targeted HSP90 inhibitor Gamitrinib-TPP (G-TPP) induces PINK1/Parkin-dependent mitophagy. Oncotarget. 2017;8:106233-106248 pubmed publisher
Su B, Ji Y, Sun X, Liu X, Chen Z. Brain-derived neurotrophic factor (BDNF)-induced mitochondrial motility arrest and presynaptic docking contribute to BDNF-enhanced synaptic transmission. J Biol Chem. 2014;289:1213-26 pubmed publisher
Chen X, Serrano D, Mayhue M, Wieden H, Stankova J, Boulay G, et al. GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation. Biochem J. 2013;449:353-64 pubmed publisher
Brickley K, Pozo K, Stephenson F. N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex. Biochim Biophys Acta. 2011;1813:269-81 pubmed publisher
Macaskill A, Brickley K, Stephenson F, Kittler J. GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons. Mol Cell Neurosci. 2009;40:301-12 pubmed publisher

product information

brand :

Novus

master code :

H00055288-M01

SKU :

H00055288-M01

product name :

Rhot1 Antibody (4H4)

description :

The Rhot1 Antibody (4H4) from Novus Biologicals is a mouse monoclonal antibody to Rhot1. This antibody reacts with human, mouse, rat. The Rhot1 Antibody (4H4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA.

target :

Rhot1

category :

Primary Antibodies

unit size :

0.1 mg

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4H4

conjugate :

Unconjugated

host :

Mouse

immunogen :

TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIP
CLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCN
TADAPSKDIFVKLTTMAMYP
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human, Mouse, Rat

specificity :

RHOT1 - ras homolog gene family, member T1

gene symbol :

RHOT1

catalog number base :

H00055288-M01

accessionNumbers :

NP_060777

applications :

Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Sandwich ELISA

2020 USD :

399

2021 USD :

399 USD

alt names :

ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.