Rhot1 Antibody (4H4) - Azide and BSA Free | Novus Biologicals H00055288-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Rhot1 Antibody (4H4) - Azide and BSA Free

catalog :

H00055288-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4H4

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry

more info or order :

Novus Biologicals product webpage

citations: 10

Reference
Guillén Samander A, Leonzino M, Hanna M, Tang N, Shen H, De Camilli P. VPS13D bridges the ER to mitochondria and peroxisomes via Miro. J Cell Biol. 2021;220: pubmed publisher
Wauters F, Cornelissen T, Imberechts D, Martin S, Koentjoro B, Sue C, et al. LRRK2 mutations impair depolarization-induced mitophagy through inhibition of mitochondrial accumulation of RAB10. Autophagy. 2019;:1-20 pubmed publisher
Palomo G, Granatiero V, Kawamata H, Konràd C, Kim M, Arreguin A, et al. Parkin is a disease modifier in the mutant SOD1 mouse model of ALS. EMBO Mol Med. 2018;10: pubmed publisher
Wang L, Gao J, Liu J, Siedlak S, Torres S, Fujioka H, et al. Mitofusin 2 Regulates Axonal Transport of Calpastatin to Prevent Neuromuscular Synaptic Elimination in Skeletal Muscles. Cell Metab. 2018;28:400-414.e8 pubmed publisher
Fiesel F, James E, Hudec R, Springer W. Mitochondrial targeted HSP90 inhibitor Gamitrinib-TPP (G-TPP) induces PINK1/Parkin-dependent mitophagy. Oncotarget. 2017;8:106233-106248 pubmed publisher
Lee C, Chin L, Li L. Hypertonia-linked protein Trak1 functions with mitofusins to promote mitochondrial tethering and fusion. Protein Cell. 2018;9:693-716 pubmed publisher
Su B, Ji Y, Sun X, Liu X, Chen Z. Brain-derived neurotrophic factor (BDNF)-induced mitochondrial motility arrest and presynaptic docking contribute to BDNF-enhanced synaptic transmission. J Biol Chem. 2014;289:1213-26 pubmed publisher
Chen X, Serrano D, Mayhue M, Wieden H, Stankova J, Boulay G, et al. GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation. Biochem J. 2013;449:353-64 pubmed publisher
Brickley K, Pozo K, Stephenson F. N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex. Biochim Biophys Acta. 2011;1813:269-81 pubmed publisher
Macaskill A, Brickley K, Stephenson F, Kittler J. GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons. Mol Cell Neurosci. 2009;40:301-12 pubmed publisher

product information

brand :

Novus

catalog number base :

H00055288-M01

SKU :

H00055288-M01

product name :

Rhot1 Antibody (4H4) - Azide and BSA Free

units size :

0.1 mg

description :

The Rhot1 Antibody (4H4) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Rhot1. This antibody reacts with human,mouse,rat. The Rhot1 Antibody (4H4) - Azide and BSA Free has been validated for the following applications: ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence.

target :

Rhot1

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4H4

conjugate :

Unconjugated

all_available conjugate :

Unconjugated

host :

Mouse

immunogen :

TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIP
CLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCN
TADAPSKDIFVKLTTMAMYP
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

gene symbol :

RHOT1

top caption :

Western Blot: Rhot1 Antibody (4H4) [H00055288-M01]

accessionNumbers :

NP_060777

applications :

ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage