This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
RNF111 Antibody (1C4)
catalog :
H00054778-M05
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C4
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
citations: 11
Reference
McIntosh D, Walters T, Arinze I, Davis J. Arkadia (RING Finger Protein 111) Mediates Sumoylation-Dependent Stabilization of Nrf2 Through K48-Linked Ubiquitination. Cell Physiol Biochem. 2018;46:418-430 pubmed publisher
van Cuijk L, van Belle G, Turkyilmaz Y, Poulsen S, Janssens R, Theil A, et al. SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair. Nat Commun. 2015;6:7499 pubmed publisher
González Prieto R, Cuijpers S, Kumar R, Hendriks I, Vertegaal A. c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4. Cell Cycle. 2015;14:1859-72 pubmed publisher
Poulsen S, Hansen R, Wagner S, van Cuijk L, van Belle G, Streicher W, et al. RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response. J Cell Biol. 2013;201:797-807 pubmed publisher
Erker Y, Neyret Kahn H, Seeler J, Dejean A, Atfi A, Levy L. Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation. Mol Cell Biol. 2013;33:2163-77 pubmed publisher
Ma T, Chen Y, Zhang F, Yang C, Wang S, Yu X. RNF111-dependent neddylation activates DNA damage-induced ubiquitination. Mol Cell. 2013;49:897-907 pubmed publisher
Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, et al. RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity. J Biol Chem. 2011;286:32502-12 pubmed publisher
Javelaud D, van Kempen L, Alexaki V, Le Scolan E, Luo K, Mauviel A. Efficient TGF-?/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression. Mol Cancer. 2011;10:2 pubmed publisher
Nagano Y, Koinuma D, Miyazawa K, Miyazono K. Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells. J Biochem. 2010;147:545-54 pubmed publisher
Nanjundan M, Cheng K, Zhang F, Lahad J, Kuo W, Schmandt R, et al. Overexpression of SnoN/SkiL, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis. Mol Oncol. 2008;2:164-81 pubmed publisher
Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill C. Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation. Mol Cell Biol. 2007;27:6068-83 pubmed
product information
brand :
Novus
master code :
H00054778-M05
SKU :
H00054778-M05
product name :
RNF111 Antibody (1C4)
description :
The RNF111 Antibody (1C4) from Novus Biologicals is a mouse monoclonal antibody to RNF111. This antibody reacts with human. The RNF111 Antibody (1C4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition, Sandwich ELISA.
target :
RNF111
category :
Primary Antibodies
unit size :
0.1 mg
buffer :
In 1x PBS, pH 7.4
clonality :
Monoclonal
clone :
1C4
conjugate :
Unconjugated
host :
Mouse
immunogen :
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLH
PEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEM
NGNQQEQEKSLVVRKKRKSQQAGPSYVQNC
RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
isotype :
IgG2a Kappa
purity :
IgG purified
species :
Human
specificity :
RNF111 - ring finger protein 111
gene symbol :
RNF111
catalog number base :
H00054778-M05
accessionNumbers :
NP_060080
applications :
Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition, Sandwich ELISA
2020 USD :
399
2021 USD :
399 USD
alt names :
ARK, Arkadia, DKFZp313E0731, DKFZp761D081, E3 ubiquitin-protein ligase Arkadia, EC 6.3.2, EC 6.3.2.-, FLJ38008, ring finger protein 111DKFZp686H1966
storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information
Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.