This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Cytokeratin 20 Antibody (2G3-1C8)
catalog :
H00054474-M01
quantity :
0.1 mg
price :
399 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2G3-1C8
reactivity :
human
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
SKU :
H00054474-M01
Product Name :
Cytokeratin 20 Antibody (2G3-1C8)
Size :
0.1 mg
Description :
The Cytokeratin 20 Antibody (2G3-1C8) from Novus is a mouse monoclonal antibody to Cytokeratin 20. This antibody reacts with human. The Cytokeratin 20 Antibody (2G3-1C8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Target :
Cytokeratin 20
Category :
Primary Antibodies
Buffer :
PBS (pH 7.4)
Clonality :
Monoclonal
Clone :
2G3-1C8
Conjugate :
Unconjugated
Host :
Mouse
Immunogen :
tag.MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSV
YGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAM
QNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRA
GRDYSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKLAA
EDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLE
IQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAA
PGLNLGVIMNEMRQKYEVMAQKNLQ
KRT20 (AAH31559, 1 a.a. ~ 425 a.a) full length recombinant protein with GST
YGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAM
QNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRA
GRDYSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKLAA
EDFRLKYETERGIRLTVEADLQGLNKVFDDLTLHKTDLE
IQIEELNKDLALLKKEHQEEVDGLHKHLGNTVNVEVDAA
PGLNLGVIMNEMRQKYEVMAQKNLQ
KRT20 (AAH31559, 1 a.a. ~ 425 a.a) full length recombinant protein with GST
Isotype :
IgG1 Kappa
Purity :
IgG purified
Species Reactivity :
Human
Gene Symbol :
KRT20
AccessionNumbers :
AAH31559
Applications :
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Price :
399 USD
Alternate Names :
CD20, CK20, CK-20, cytokeratin-20, K20cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT
Storage :
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
