JAM-A Antibody (2E3-1C8) - Azide and BSA Free | Novus Biologicals H00050848-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

JAM-A Antibody (2E3-1C8) - Azide and BSA Free

catalog :

H00050848-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2E3-1C8

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, proximity ligation assay

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Harryvan T, Golo M, Dam N, Schoonderwoerd M, Farshadi E, Hornsveld M, et al. Gastrointestinal cancer-associated fibroblasts expressing Junctional Adhesion Molecule-A are amenable to infection by oncolytic reovirus. Cancer Gene Ther. 2022;29:1918-1929 pubmed publisher
Richards C, Sheehan K, Kay E, Hedner C, Borg D, Fay J, et al. Development of a Novel Weighted Ranking Method for Immunohistochemical Quantification of a Heterogeneously Expressed Protein in Gastro-Esophageal Cancers. Cancers (Basel). 2021;13: pubmed publisher
Communal L, Medrano M, Sircoulomb F, Paterson J, K xf6 bel M, Rahimi K, et al. Low junctional adhesion molecule-A expression is associated with an epithelial to mesenchymal transition and poorer outcomes in high-grade serous carcinoma of uterine adnexa. Mod Pathol. 2020;33:2361-2377 pubmed publisher
Neutzner A, Power L, Dürrenberger M, Scholl H, Meyer P, Killer H, et al. A perfusion bioreactor-based 3D model of the subarachnoid space based on a meningeal tissue construct. Fluids Barriers CNS. 2019;16:17 pubmed publisher
Choi Y, Baek K, Choi Y. Estrogen reinforces barrier formation and protects against tumor necrosis factor alpha-induced barrier dysfunction in oral epithelial cells. J Periodontal Implant Sci. 2018;48:284-294 pubmed publisher
Vellanki S, Cruz R, Jahns H, Hudson L, Sette G, Eramo A, et al. Natural compound Tetrocarcin-A downregulates Junctional Adhesion Molecule-A in conjunction with HER2 and inhibitor of apoptosis proteins and inhibits tumor cell growth. Cancer Lett. 2018;440-441:23-34 pubmed publisher
Zeleny T, Kohler C, Neutzner A, Killer H, Meyer P. Cell-Cell Interaction Proteins (Gap Junctions, Tight Junctions, and Desmosomes) and Water Transporter Aquaporin 4 in Meningothelial Cells of the Human Optic Nerve. Front Neurol. 2017;8:308 pubmed publisher
Huang J, Xu Y, Sun Z, Wang Z, Zhu Z, Song Y, et al. Low junctional adhesion molecule A expression correlates with poor prognosis in gastric cancer. J Surg Res. 2014;192:494-502 pubmed publisher
Fong D, Spizzo G, Mitterer M, Seeber A, Steurer M, Gastl G, et al. Low expression of junctional adhesion molecule A is associated with metastasis and poor survival in pancreatic cancer. Ann Surg Oncol. 2012;19:4330-6 pubmed publisher
McSherry E, McGee S, Jirstrom K, Doyle E, Brennan D, Landberg G, et al. JAM-A expression positively correlates with poor prognosis in breast cancer patients. Int J Cancer. 2009;125:1343-51 pubmed publisher
Gutwein P, Schramme A, Voss B, Abdel Bakky M, Doberstein K, Ludwig A, et al. Downregulation of junctional adhesion molecule-A is involved in the progression of clear cell renal cell carcinoma. Biochem Biophys Res Commun. 2009;380:387-91 pubmed publisher

product information

master code :

H00050848-M01

SKU :

H00050848-M01

product name :

JAM-A Antibody (2E3-1C8) - Azide and BSA Free

unit size :

0.1 mg

description :

The JAM-A Antibody (2E3-1C8) - Azide and BSA Free from Novus is a mouse monoclonal antibody to JAM-A. This antibody reacts with human. The JAM-A Antibody (2E3-1C8) - Azide and BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Western Blot,Proximity Ligation Assay,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

JAM-A

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

2E3-1C8

conjugate :

Unconjugated

host :

Mouse

immunogen :

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVR
IPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNK
ITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGN
SYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQ
DGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTG
ELVFDPLSASDTGEYSCEARNGYGTPMTSNAVRMEAVER
NVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGT
SSKKVIYSQPSARSEGEFKQTSSFLV
F11R (AAH01533, 1 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG1 Kappa

purity :

IgG purified

species :

Human

specificity :

F11R - F11 receptor

gene symbol :

F11R

accessionNumbers :

AAH01533

applications :

IF/IHC,Immunohistochemistry-Paraffin,ELISA,Immunohistochemistry,Western Blot,Proximity Ligation Assay,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

CD321 antigen, F11 receptor, JAM-1, JAM1CD321, JAMA, JAM-A, JCAMJAM, Junctional adhesion molecule 1Platelet F11 receptor, junctional adhesion molecule A, PAM-1KAT, Platelet adhesion molecule 1

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage