ERO1L Antibody (4G3) - Azide and BSA Free | Novus Biologicals H00030001-M01 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ERO1L Antibody (4G3) - Azide and BSA Free

catalog :

H00030001-M01

quantity :

0.1 mg

price :

529 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4G3

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 12

Reference
Chen F, Sun J, Wang Y, Grunberger J, Zheng Z, Khurana N, et al. Silica nanoparticles induce ovarian granulosa cell apoptosis via activation of the PERK-ATF4-CHOP-ERO1α pathway-mediated IP3R1-dependent calcium mobilization. Cell Biol Toxicol. 2023;39:1715-1734 pubmed publisher
Zilli F, Marques Ramos P, Auf der Maur P, Jehanno C, Sethi A, Coissieux M, et al. The NFIB-ERO1A axis promotes breast cancer metastatic colonization of disseminated tumour cells. EMBO Mol Med. 2021;13:e13162 pubmed publisher
Hu J, Jin J, Qu Y, Liu W, Ma Z, Zhang J, et al. ERO1α inhibits cell apoptosis and regulates steroidogenesis in mouse granulosa cells. Mol Cell Endocrinol. 2020;511:110842 pubmed publisher
Chen F, Wang Y, Liu Q, Hu J, Jin J, Ma Z, et al. ERO1α promotes testosterone secretion in hCG-stimulated mouse Leydig cells via activation of the PI3K/AKT/mTOR signaling pathway. J Cell Physiol. 2020;235:5666-5678 pubmed publisher
Takei N, Yoneda A, Kosaka M, Sakai Sawada K, Tamura Y. ERO1α is a novel endogenous marker of hypoxia in human cancer cell lines. BMC Cancer. 2019;19:510 pubmed publisher
Kim K, An A, Park H, Jang K, Moon W, Kang M, et al. Combined expression of protein disulfide isomerase and endoplasmic reticulum oxidoreductin 1-α is a poor prognostic marker for non-small cell lung cancer. Oncol Lett. 2018;16:5753-5760 pubmed publisher
Kim J, Haque M, Goo T, Moon I. Alleviation of Hippocampal Endoplasmic Reticulum Stress by Allomyrina dichotoma Larvae Extract. Am J Chin Med. 2018;46:633-650 pubmed publisher
Kim J, Yun E, Quan F, Park S, Goo T. Central Administration of 1-Deoxynojirimycin Attenuates Hypothalamic Endoplasmic Reticulum Stress and Regulates Food Intake and Body Weight in Mice with High-Fat Diet-Induced Obesity. Evid Based Complement Alternat Med. 2017;2017:3607089 pubmed publisher
Hsu C, Hsu C, Hsueh C, Wang C, Wu Y, Wu C, et al. Identification and Characterization of Potential Biomarkers by Quantitative Tissue Proteomics of Primary Lung Adenocarcinoma. Mol Cell Proteomics. 2016;15:2396-410 pubmed publisher
Tanaka T, Kutomi G, Kajiwara T, Kukita K, Kochin V, Kanaseki T, et al. Cancer-associated oxidoreductase ERO1-Î± drives the production of VEGF via oxidative protein folding and regulating the mRNA level. Br J Cancer. 2016;114:1227-34 pubmed publisher
Kim J, Yun E, Park S, Goo T, Seo M. Allomyrina Dichotoma Larvae Regulate Food Intake and Body Weight in High Fat Diet-Induced Obese Mice Through mTOR and Mapk Signaling Pathways. Nutrients. 2016;8:100 pubmed publisher
Araki K, Iemura S, Kamiya Y, Ron D, Kato K, Natsume T, et al. Ero1-Î± and PDIs constitute a hierarchical electron transfer network of endoplasmic reticulum oxidoreductases. J Cell Biol. 2013;202:861-74 pubmed publisher

product information

master code :

H00030001-M01

SKU :

H00030001-M01

product name :

ERO1L Antibody (4G3) - Azide and BSA Free

unit size :

0.1 mg

description :

The ERO1L Antibody (4G3) - Azide and BSA Free from Novus is a mouse monoclonal antibody to ERO1L. This antibody reacts with human,mouse,rat. The ERO1L Antibody (4G3) - Azide and BSA Free has been validated for the following applications: ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence.

target :

ERO1L

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

4G3

conjugate :

Unconjugated

host :

Mouse

immunogen :

DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLI
EECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCE
ADDIQSPEAEY
ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2b Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

ERO1L - ERO1-like (S

gene symbol :

ERO1A

accessionNumbers :

NP_055399

applications :

ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence

USD :

529 USD

alt names :

EC 1.8.4, EC 1.8.4.-, Endoplasmic oxidoreductin-1-like protein, ERO1 (S. cerevisiae)-like, ERO1A, ERO1-alpha, ERO1-L, ERO1-L-alpha, ERO1-like (S. cerevisiae), ERO1-like protein alpha, oxidoreductin-1-L-alpha

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage