Ubiquilin 2 Antibody (5F5) - Azide and BSA Free | Novus Biologicals H00029978-M03 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Ubiquilin 2 Antibody (5F5) - Azide and BSA Free

catalog :

H00029978-M03

quantity :

0.1 mg

price :

499 USD

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5F5

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 28

Reference
Nementzik L, Thumbadoo K, Murray H, Gordon D, Yang S, Blair I, et al. Distribution of ubiquilin 2 and TDP-43 aggregates throughout the CNS in UBQLN2 p.T487I-linked amyotrophic lateral sclerosis and frontotemporal dementia. Brain Pathol. 2024;34:e13230 pubmed publisher
Halloran M, Ragagnin A, Vidal M, Parakh S, Yang S, Heng B, et al. Amyotrophic lateral sclerosis-linked UBQLN2 mutants inhibit endoplasmic reticulum to Golgi transport, leading to Golgi fragmentation and ER stress. Cell Mol Life Sci. 2019;: pubmed publisher
Chen T, Huang B, Shi X, Gao L, Huang C. Mutant UBQLN2P497H in motor neurons leads to ALS-like phenotypes and defective autophagy in rats. Acta Neuropathol Commun. 2018;6:122 pubmed publisher
Riku Y, Watanabe H, Yoshida M, Mimuro M, Iwasaki Y, Masuda M, et al. Pathologic Involvement of Glutamatergic Striatal Inputs From the Cortices in TAR DNA-Binding Protein 43?kDa-Related Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis. J Neuropathol Exp Neurol. 2017;76:759-768 pubmed publisher
Wang C, Huang Y, Chen P, Cheng Y, Kao H, Pi H, et al. USP5/Leon deubiquitinase confines postsynaptic growth by maintaining ubiquitin homeostasis through Ubiquilin. elife. 2017;6: pubmed publisher
Riku Y, Watanabe H, Yoshida M, Mimuro M, Iwasaki Y, Masuda M, et al. Marked Involvement of the Striatal Efferent System in TAR DNA-Binding Protein 43?kDa-Related Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis. J Neuropathol Exp Neurol. 2016;: pubmed
Arvaniti M, Jensen M, Soni N, Wang H, Klein A, Thiriet N, et al. Functional interaction between Lypd6 and nicotinic acetylcholine receptors. J Neurochem. 2016;138:806-20 pubmed publisher
Ito M, Nakamura K, Mori F, Miki Y, Tanji K, Wakabayashi K. Novel eosinophilic neuronal cytoplasmic inclusions in the external cuneate nucleus of humans. Neuropathology. 2016;36:441-447 pubmed publisher
Wear M, Kryndushkin D, O Meally R, Sonnenberg J, Cole R, Shewmaker F. Proteins with Intrinsically Disordered Domains Are Preferentially Recruited to Polyglutamine Aggregates. PLoS ONE. 2015;10:e0136362 pubmed publisher
Shimada K, Fujii T, Tatsumi Y, Anai S, Fujimoto K, Konishi N. Ubiquilin2 as a novel marker for detection of urothelial carcinoma cells in urine. Diagn Cytopathol. 2016;44:3-9 pubmed publisher
Zeng L, Wang B, Merillat S, Minakawa E, Perkins M, Ramani B, et al. Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3. Neurobiol Dis. 2015;82:281-288 pubmed publisher
Freischmidt A, Wieland T, Richter B, Ruf W, Schaeffer V, MÃ¼ller K, et al. Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia. Nat Neurosci. 2015;18:631-6 pubmed publisher
Porta S, Kwong L, Trojanowski J, Lee V. Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases. J Neuropathol Exp Neurol. 2015;74:380-7 pubmed publisher
Wu Q, Liu M, Huang C, Liu X, Huang B, Li N, et al. Pathogenic Ubqln2 gains toxic properties to induce neuron death. Acta Neuropathol. 2015;129:417-28 pubmed publisher
Fawzi A, Simonett J, Purta P, Moss H, Lowry J, Deng H, et al. Clinicopathologic report of ocular involvement in ALS patients with C9orf72 mutation. Amyotroph Lateral Scler Frontotemporal Degener. 2014;15:569-80 pubmed publisher
Konno T, Tada M, Shiga A, Tsujino A, Eguchi H, Masuda Suzukake M, et al. C9ORF72 repeat-associated non-ATG-translated polypeptides are distributed independently of TDP-43 in a Japanese patient with c9ALS. Neuropathol Appl Neurobiol. 2014;40:783-8 pubmed publisher
Farg M, Sundaramoorthy V, Sultana J, Yang S, Atkinson R, Levina V, et al. C9ORF72, implicated in amytrophic lateral sclerosis and frontotemporal dementia, regulates endosomal trafficking. Hum Mol Genet. 2014;23:3579-95 pubmed publisher
Safren N, El Ayadi A, Chang L, Terrillion C, Gould T, BOEHNING D, et al. Ubiquilin-1 overexpression increases the lifespan and delays accumulation of Huntingtin aggregates in the R6/2 mouse model of Huntington's disease. PLoS ONE. 2014;9:e87513 pubmed publisher
Riku Y, Watanabe H, Yoshida M, Tatsumi S, Mimuro M, Iwasaki Y, et al. Lower motor neuron involvement in TAR DNA-binding protein of 43 kDa-related frontotemporal lobar degeneration and amyotrophic lateral sclerosis. JAMA Neurol. 2014;71:172-9 pubmed publisher
Nölle A, van Haastert E, Zwart R, Hoozemans J, Scheper W. Ubiquilin 2 is not associated with tau pathology. PLoS ONE. 2013;8:e76598 pubmed publisher
Murray M, Bieniek K, Banks Greenberg M, DeJesus Hernandez M, Rutherford N, van Blitterswijk M, et al. Progressive amnestic dementia, hippocampal sclerosis, and mutation in C9ORF72. Acta Neuropathol. 2013;126:545-54 pubmed publisher
Shimizu H, Toyoshima Y, Shiga A, Yokoseki A, Arakawa K, Sekine Y, et al. Sporadic ALS with compound heterozygous mutations in the SQSTM1 gene. Acta Neuropathol. 2013;126:453-9 pubmed publisher
Satoh J, Tabunoki H, Ishida T, Saito Y, Arima K. Ubiquilin-1 immunoreactivity is concentrated on Hirano bodies and dystrophic neurites in Alzheimer's disease brains. Neuropathol Appl Neurobiol. 2013;39:817-30 pubmed publisher
Pelletier S, Gingras S, Howell S, Vogel P, Ihle J. An early onset progressive motor neuron disorder in Scyl1-deficient mice is associated with mislocalization of TDP-43. J Neurosci. 2012;32:16560-73 pubmed publisher
Bieniek K, Murray M, Rutherford N, Castanedes Casey M, DeJesus Hernandez M, Liesinger A, et al. Tau pathology in frontotemporal lobar degeneration with C9ORF72 hexanucleotide repeat expansion. Acta Neuropathol. 2013;125:289-302 pubmed publisher
Brettschneider J, Van Deerlin V, Robinson J, Kwong L, Lee E, Ali Y, et al. Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion. Acta Neuropathol. 2012;123:825-39 pubmed publisher
Al Sarraj S, King A, Troakes C, Smith B, Maekawa S, Bodi I, et al. p62 positive, TDP-43 negative, neuronal cytoplasmic and intranuclear inclusions in the cerebellum and hippocampus define the pathology of C9orf72-linked FTLD and MND/ALS. Acta Neuropathol. 2011;122:691-702 pubmed publisher
Deng H, Chen W, Hong S, Boycott K, Gorrie G, Siddique N, et al. Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. Nature. 2011;477:211-5 pubmed publisher

product information

master code :

H00029978-M03

SKU :

H00029978-M03

product name :

Ubiquilin 2 Antibody (5F5) - Azide and BSA Free

unit size :

0.1 mg

description :

The Ubiquilin 2 Antibody (5F5) - Azide and BSA Free from Novus is a mouse monoclonal antibody to Ubiquilin 2. This antibody reacts with human,mouse,rat. The Ubiquilin 2 Antibody (5F5) - Azide and BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,ELISA,Knockdown Validated.

target :

Ubiquilin 2

category :

Primary Antibodies

buffer :

In 1x PBS, pH 7.4

clonality :

Monoclonal

clone :

5F5

conjugate :

Unconjugated

host :

Mouse

immunogen :

PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMG
FLNREANLQALIATGGDINAAIERLLGSQPS
UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

isotype :

IgG2a Kappa

purity :

IgG purified

species :

Human,Mouse,Rat

specificity :

UBQLN2 (5F5)

gene symbol :

UBQLN2

Antibody validation :

Knockout/Knockdown

accessionNumbers :

NP_038472

applications :

Immunohistochemistry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,ELISA,Knockdown Validated

USD :

499 USD

alt names :

Chap1, CHAP1/DSK2, DSK2, DSK2 homolog, FLJ10167, FLJ56541, hPLIC-2, N4BP4LIC-2, Nedd4 binding protein 4, PLIC-2, PLIC2Dsk2, Protein linking IAP with cytoskeleton 2, RIHFB2157, ubiquilin 2, ubiquilin-2, Ubiquitin-like product Chap1/Dsk2

storage :

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage